KEGG   Pan troglodytes (chimpanzee): 464147Help
Entry
464147            CDS       T01005                                 

Gene name
MYST3
Definition
MYST histone acetyltransferase (monocytic leukemia) 3
Orthology
K11305  
histone acetyltransferase MYST3 [EC:2.3.1.48]
Organism
ptr  Pan troglodytes (chimpanzee)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
8
AA seq 2002 aa AA seqDB search
MVKLANPLYTEWILEAIKKVKKQKQRPSEERICNAVSSSHGLDRKTVLEQLELSVKDGTI
LKVSNKGLNSYKDPDNPGRIALPKPRNHGKLDNKQNVDWNKLIKRAVEGLAESGGSTLKS
IERFLKGQKDVSALFGGSAASGFHQQLRLAIKRAIGHGRLLKDGPLYRLNTKATNVDGKE
SCESLSCLPPVSLLPHEKDKPVAEPIPICSFCLGTKEQNREKKPEELISCADCGNSGHPS
CLKFSPELTVRVKALRWQCIECKTCSSCRDQGKNADNMLFCDSCDRGFHMECCDPPLTRM
PKGMWICQICRPRKKGRKLLQKKAAQIKRRYTNPIGRPKNRLKKQNTVSKGPFSKVRTGP
GRGRKRKITLSSQSASSSSSEGYLERIDGLDFCRDSNVSLKFNKKTKGLIDGLTKFFTPS
PDGRKARGEVVDYSEQYRIRKRGNRKSSTSDWPTDNQDGWDGKQENEERLFGSQEIMTEK
DMELFRDIQEQALQKVGVTGPPDPQVRCPSVIEFGKYEIHTWYSSPYPQEYSRLPKLYLC
EFCLKYMKSRTILQQHMKKCGWFHPPANEIYRKNNISVFEVDGNVSTIYCQNLCLLAKLF
LDHKTLYYDVEPFLFYVLTQNDVKGCHLVGYFSKEKHCQQKYNVSCIMILPQYQRKGYGR
FLIDFSYLLSKREGQAGSPEKPLSDLGRLSYMAYWKSVILECLYHQNDKQISIKKLSKLT
GICPQDITSTLHHLRMLDFRSDQFVIIRREKLIQDHMAKLQLNLRPVDVDPECLRWTPVI
VSNSVVSEEEEEEAEEGENEEPQCQERELEISVGKSVSHENKEQDSYSVESEKKPEVMAP
VSSTRLSKQVLPRDSLPANSQPSRRGRWGRKNRKTQERFGDKDSKLLLEETSSAPQEQYG
ECEEKSEATQEEYTESEEQLVASEEQPSQDGKPDLPKRRLSEGVEPWRGQLKKSPEALKC
RLTEGNERLPRRYSEGDRAVLRGFSESSEEEEEPESPRSSSPPILTKPTLKRKKPFLHRR
RRVRKRKHHNSSVVTETISETTEVLDEPFEDSDSERPMPRLEPTFEIDEEEEEEDENELF
PREYFRRLSSQDVLRCQSSSKRKSKDEEEDEESDDADDTPILKPVSLLRKRDVKNSPLEP
DTSTPLKKKKGWPKGKSRKPIHWKKRPGRKPGFKLSREIMPVSTQACVIEPIVSIPKAGR
KPKIQESEETVEPKEDMPLPEERKEEEEMQAEAEEAEEGEEEDAASSEVPAASPADSSNS
PETETKEPEVEEEEEKPRVSEEQRQSEEEQQELEEPEPEEEEDAAAETAQNDDHDADDED
DGHLESTKKKELEEQPTREDVKEEPGVQESFLDANMQKSREKIKDKEETELDSEEEQPSH
DTSVVSEQMPGSEDDHEEDSHTKEELIELKEEEEIPHSELDLETVQAVQSLTQEESSEHE
GAYQDCEETLAACQTLQSYTQADEDPQMSMVEDCHASEHNSPISSVQSHPSQSVRSVSSP
NVPPLESGYTQISPEQGSLSAPSMQNMETSPMMDVPSVSDHSQQVVDSGFSDLGSIESTT
ENYENPSSYDSTMGGSICGNSSSQSSCSYGGLSSSSSLTQSSCVVTQQMASMGSSCSMMQ
QSSVQPAANCSIKSPQSCVVERPPSNQQQQPPPRPSQQPQPPPPQPAPQPPPPQQQPQQQ
PQPQPQQPPPPPPPQQQPPLSQCSMNNSFTPAPMIMEIPESGSTGNISIYERIPGDFGAG
SYSQPSATFSLAKLQQLTNTIMDPHAMPYSHSPAVTSYATSVSLSNTGLAQLAPSHPLAG
TPQAQATMTPPPNLASTTMNLTSPLLQCNMSATNIGIPHTQRLQGQMPVKGHISIRSKSA
PLPSAAAHQQQLYGRSPSAVAMQAGPRTLAVQRGMNMGVNLMPTPAYNVNSMNMNTLNAM
NSYRMTQPMMNSSYHSNPAYMNQTAQYPMQMQMGMMGSQAYTQQPMQPNPHGNMMYTGPS
HHSYMNAAGVPKQSLNGPYMRR
NT seq 6009 nt NT seq  +upstreamnt  +downstreamnt
atggtaaaactcgcaaacccgctttatactgagtggattttggaggccatcaaaaaagtg
aaaaagcagaaacagcgtccttcagaagaaaggatatgcaatgctgtgtcttcatcccat
ggcttggatcgtaaaactgttttagaacaattggagttgagtgttaaagatggaacaatt
ttaaaagtctcaaataaaggactcaattcctataaagatcctgataatcctgggcgaata
gcacttcctaagcctcggaaccatggaaaattggataataaacaaaatgtggattggaat
aaactgataaagcgggcagttgagggcttggcagagtccggtggctcaactttgaaaagc
attgaacgttttttgaaaggtcagaaggatgtgtctgcattattcggaggcagtgctgcc
tctggctttcaccagcagttacgattggctatcaaacgtgccattggccacggcagactc
cttaaagatggacctctttatcggctcaacactaaagcaaccaacgtggatgggaaagag
agttgtgagtctctttcctgtttacctccagtgtcccttcttccacatgaaaaggataag
ccggttgctgaaccaatccccatctgtagtttctgtcttggtacaaaagaacaaaaccga
gaaaagaagccagaggaactcatctcctgtgccgactgtggcaacagtggccatccatcc
tgtttaaagttttcccctgaactaacggttagagtgaaggccttacggtggcagtgcatc
gagtgtaaaacatgcagctcctgtcgagatcaaggcaaaaatgcggataacatgctcttt
tgtgattcatgtgaccgaggttttcacatggagtgttgtgatccgccactcacccgtatg
ccaaaaggcatgtggatatgtcaaatatgtcgacctaggaaaaaaggacgaaaacttcta
caaaagaaggcagcacagataaaacggcgctatactaatccaataggacgtccaaaaaac
aggttaaagaaacaaaacacggtatcaaaaggtcccttcagcaaagttcgaactggccct
ggaaggggtaggaaacgaaaaatcactctttccagccaatcagcatcatcatcatcatca
gaaggatatttagagcggatagatggcttggacttctgcagagatagcaatgtctccttg
aagttcaacaagaaaaccaaagggctcattgatggccttaccaaattttttaccccttcc
cctgatgggcggaaagctcggggggaagtggtggactactccgagcaatatcgaatcaga
aagaggggcaacaggaaatcaagcacttcagattggcccacggacaatcaggatggctgg
gatggcaaacaagaaaatgaggagcgactttttgggagccaggaaatcatgactgagaaa
gatatggaattatttcgtgatatccaagaacaagcactgcagaaagttggagtgactggt
ccccctgatccacaagtccgctgtccctctgtcattgagtttgggaagtatgaaattcac
acctggtactcctccccatatcctcaagaatactcaaggctgcccaaattgtatctttgt
gaattttgtctaaaatatatgaaaagtagaactattctgcagcagcacatgaagaaatgt
ggttggttccatcctcctgccaatgagatttacagaaagaataatatttctgtctttgag
gttgatgggaatgtgagtaccatttattgtcaaaacctgtgtctcttggcaaagttgttt
cttgaccacaaaaccctctattacgatgtggagccatttcttttttatgtactaacacag
aatgatgtcaagggctgccaccttgttggctacttttctaaggaaaagcactgccaacag
aagtacaatgtttcctgtataatgattcttcctcaataccagcgtaagggctatggcagg
tttctcatcgatttcagttatttgttatcaaagcgtgaaggccaagcagggtctccagag
aaaccgttatctgatctgggtcgtctttcctacatggcatattggaaaagtgtaatattg
gagtgcctttatcaccaaaatgacaagcagatcagcattaagaagttaagcaagttgact
ggaatctgccctcaagacatcacttccacactccaccacctacgaatgctggacttccgt
agtgaccaatttgtgattatccgccgggaaaaacttatccaggatcacatggcaaagctt
cagctgaatttgcgacctgtagatgtagatccagaatgtttgcgctggactccagtcata
gtgtccaactctgtggtctcagaggaggaagaagaggaggctgaggaaggagaaaatgaa
gagccacagtgccaggaaagagaattagagatcagtgtgggaaagtctgtgtctcatgag
aacaaagaacaagattcttattcagtagaaagtgaaaagaaaccagaagttatggctcca
gtcagttctacacgtttgagcaaacaagtccttcctcgtgatagtcttcctgcaaatagc
cagccatctcggaggggccgctgggggaggaagaacagaaaaacccaggaacgttttggt
gataaagattctaaactgctcttggaagagacgtcttcagctcctcaggaacaatatgga
gaatgtgaggagaaatcagaagccacccaggaagaatacactgaaagtgaagaacagctg
gtggcttctgaggagcagccaagccaggacgggaaacctgaccttcccaagagaagactc
agtgagggggttgagccctggcgaggacagctcaagaaaagccctgaggctctgaagtgc
agattaacagaaggaaatgagaggctgccccgtcgctacagtgagggtgacagggctgtc
ctcaggggcttcagtgagagcagcgaggaggaggaggagccggaaagccctcggtcaagc
tcgccaccaattctcacaaagcccacgctgaagcgaaagaaaccatttctccaccgaagg
aggagagtccgaaagcgcaaacaccacaatagcagtgtagtcacagaaactatttctgag
accactgaagtgttagatgaaccttttgaagattctgactccgagaggccaatgccaaga
ttagaacccacgtttgagatcgatgaagaagaggaggaagaggatgaaaatgaacttttc
cctagagaatacttccgtcgtttgtcttcgcaggatgtactcaggtgtcagtcctcttct
aagaggaagtctaaagatgaagaagaagatgaagagtcagatgatgctgatgacactcct
atcttaaagccagtatctcttttgcgaaaacgtgatgtgaagaattctcctcttgagcca
gatacatccacacctttgaaaaagaaaaagggatggcccaaaggcaagagccgcaaacca
atccactggaagaaaagacctggtcgaaaaccaggatttaagttgagtcgggaaatcatg
ccagtttctactcaagcatgcgtcattgagcccatcgtttccattcctaaagctggacgt
aaacccaagatccaggagagtgaagaaactgttgagccaaaagaagacatgcccctaccc
gaggagaggaaggaggaggaggagatgcaagcagaggcagaagaggctgaagagggtgag
gaagaggatgcagccagcagtgaagtcccagcagcctctccagcagacagcagcaatagt
cctgagaccgaaaccaaggagcctgaggtggaggaggaagaagagaagccccgtgtctca
gaggagcagaggcagtcagaggaggagcagcaggaattagaggagccagagccagaggag
gaggaagatgcagctgcagagactgcccagaatgacgaccacgacgctgatgatgaggat
gatggccacctggagtccacaaagaaaaaggagctagaggaacagcccacgagggaagat
gtcaaggaggagcctggtgttcaagagtcttttttagatgctaatatgcagaagagtagg
gaaaagataaaggataaagaggaaaccgagctggattccgaagaggagcagccttcccat
gacacgtccgtggtgtcagagcagatgcctgggtctgaggacgaccacgaagaagactcc
cacactaaggaagagttaatcgaattaaaagaggaggaagagattcctcatagtgagctg
gatctggaaactgtacaggcagtgcagtctttgactcaagaagaaagcagtgagcatgag
ggcgcctaccaggactgtgaggaaactcttgcggcgtgtcagaccctgcagagttacacc
caggctgacgaggaccctcagatgtccatggttgaagactgtcatgcgtcagaacataat
agccctatctcctctgttcagtctcaccccagccagtcagtccgttcggtcagcagtccc
aacgtgcctcccctcgagagtggctacacccagatcagcccagaacaaggatccctgtcc
gcgccctctatgcagaacatggagaccagccccatgatggatgtgccttccgtatcagac
cactctcagcaggtggtggacagcggcttcagtgacctgggcagcattgagagcaccact
gaaaactatgagaacccgagcagttacgactccacgatgggcggcagcatctgtgggaac
agctcttcccagagcagctgctcctacggtgggctgtcgtcctccagcagcctcacccag
agcagctgtgtggtcactcagcagatggccagcatgggcagcagctgcagcatgatgcag
cagagcagcgtccagcctgctgccaactgcagcatcaagtcacctcagagctgcgtggtg
gagaggcctcccagtaaccagcagcagcagccgccaccacgcccttcacagcagccacag
ccgccgccgccacaaccagcaccacagcctccaccaccccagcagcagccgcagcagcag
ccgcagcctcagccccagcagcctccacccccaccccctccccagcagcagcccccgctg
tcacagtgtagtatgaataacagtttcaccccagctcctatgatcatggagataccagaa
tctggaagcactgggaacataagtatctatgagaggattccaggggattttggtgccggc
agctactctcaaccatcagccaccttcagcctagccaagctgcagcagctgaccaacacc
attatggaccctcatgccatgccttatagccattctcctgctgtgacttcctatgcaacc
agtgtttctctgtccaatacaggactggctcagctggctccatctcatcccttagctggg
actcctcaagcacaagccaccatgacgccacccccaaacttggcatccactaccatgaac
ctcacatctcctctgcttcagtgcaacatgtctgccaccaacattggcattcctcacacg
cagagattgcaagggcaaatgccagtgaaggggcacatttccatccgctccaagtctgcg
ccactgccctctgcggctgctcaccagcagcagctgtatggccgtagcccatcggcagtt
gccatgcaggctggccctcgcacactggctgttcagcgtggcatgaacatgggggttaat
ctgatgcctactcccgcctataatgtcaattccatgaatatgaacaccttgaatgccatg
aacagctatcgaatgacacagcccatgatgaacagcagttaccatagtaaccctgcctac
atgaaccagacagcacagtatcctatgcagatgcagatgggaatgatggggagccaggcc
tatacccagcagcctatgcagcctaaccctcatgggaacatgatgtacacaggcccctcc
catcacagctacatgaacgctgctggcgtgcccaagcagtcactcaacggcccttacatg
agaagatga

DBGET integrated database retrieval system