KEGG   Pan troglodytes (chimpanzee): 464150Help
Entry
464150            CDS       T01005                                 

Gene name
UNC13B
Definition
(RefSeq) unc-13 homolog B (C. elegans)
  KO
K15293  
protein unc-13 A/B/C
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
Synaptic vesicle cycle
Brite
KEGG Orthology (KO) [BR:ptr00001]
 Organismal Systems
  Nervous system
   04721 Synaptic vesicle cycle
    464150 (UNC13B)
Membrane trafficking [BR:ptr04131]
 SNARE
  SNARE associated proteins
   Syntaxin-binding proteins
    464150 (UNC13B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
Position
9
AA seq 2002 aa AA seqDB search
MKRLLQESEEEIMVTLGPSSRLSPDKAKAETMCGTKSKSSGPAGSLPEDNSLPPCCGSAA
LAIGGDRDGDLAQLCSFGQQNNSQLPLGSTAYVSGSGSQDPSSVSITTSCQEPSERNQAK
TLLSRGHGQGCSREQREPLGDVVEYIIRELQGISRLQTEIAELQQHLSQVRGSVDEVSSC
VDSVLSEIEGLQVSSCSLAKVCEGEKAQEPHVDRPSEEAILYLYGLPEQDGENTMELVES
FLAKHLCVNGMQCNRYIKKAYRAGTSPSPRPTVVKLAHLEHRDFILQKSILLQNVGVRIA
TREEPSCPQGNKNPQKESISFFQQQHQDYSQTSLNQDEPVLQMETGDRGPITGTYQMKAQ
DQQREHQAPEQQGPCFLLKNNLSKESDVPKLGDEIKGASRTSQVISGSCDELSEKKASLS
TPHQFEEPALVLISKEEASGKSQFFKQYSQKHEACKVGKPENDCHDKSEASSCLSLSGLL
KTERINAEDKLLGCEAGLDILSSKELEDLLADKSRRLAALSCDSMMEEIIIGPETFSDMV
HIDLNEEEECAAHVLKDVFDKSSCVLGGSQEDEDVEIKFYTSKLGRAIHHFRSALQGVFQ
KLENSGSISPEDLESNESGSQSENSDRLLGTVSSGGAQDCSLESPGSQGSESLLSVVSGG
VGVSTQGEQTPQDPSTFSLASNNSLPSVALAPCLGSETCSRPGSPKQDRLSLEQVCTETV
YLNKCINNFKNVLREKRLRQKKLLHELVQKANHLSVEDIHSEEKRGALQIPDDGDPSLPQ
WLPEGPAGGLYGIDSMPDLRRKKPLPLVSDLAMSLVQSRKAGITSAMATRTSLKDEELKS
HVYKKTLQALIYPISCTTPHNFEVWTATTPTYCYECEGLLWGIARQGMRCSECGVKCHEK
CQDLLNADCLQRDLLCSWPPSGAAEKSCKHGAEDRTQNIIMAMKDRMKIRERNKPEIFEV
IRDVFTVNKAAHVQQMKTVKQSVLDGTSKWSAKITITVVCAQGLQAKDKTGSSDPYVTVQ
VSKTKKRTKTIFGNLNPVWEEKFHFECHNSSDRIKVRVWDEDDDIKSRVKQRLKRESDDF
LGQTIIEVRTLSGEMDVWYNLEKRTDKSAVSGAIRLQISVEIKGEEKVAPYHVQYTCLHE
NLFHYLTDIQGSGGVRIPEARGDDAWKVYFDETAQEIVDEFAMRYGIESIYQAMTHFACL
SSKYMCPGVPAVMSTLLANINAYYAHTTASTNVSASDRFAASNFGKERFVKLLDQLHNSL
RIDLSTYRNNFPAGSPERLQDLKSTVDLLTSITFFRMKVQELQSPPRASQVVKDCVKACL
NSTYEYIFNNCHDLYSRQYQLKQELPPEEQGPSIRNLDFWPKLITLIVSIIEEDKNSYTP
VLNQFPQELNVGKVSAEVMWHLFAQDMKYALEEHEKAHLCKSADYMNLHFKVKWLHNEYV
RDLPVLQGQVPEYPAWFEQFVLQWLDENEDVSLEFLRGALERDKKDGFQQTSEHALFSCS
VVDVFTQLNQSFEIIRKLECPDPSILAHYMRRFAKTIGKVLMQYADILSKDFPAYCTKEK
LPCILMNNMQQLRVQLEKMFEAMGGKELDLEAADSLKELQVKLNTVLDELSMVFGNSFQV
RIDECVRQMADILGQVRGTGNASPDARASAAQDADSVLRPLMDFLDGNLTLFATVCEKTV
LKRVLKELWRVVMNTMERMIVLPPLTDQTGTQLIFTAAKELSHLSKLKDHMVREETRNLT
PKQCAVLDLALDTIKQYFHAGGNGLKKTFLEKSPDLQSLRYALSLYTQTTDTLIKTFVRS
QTTQVHDGKGIRFTANEDIRPEKGSGVDDPVGEVSIQVDLFTHPGTGEHKVTVKVVAAND
LKWQTAGMFRPFVEVTMVGPHQSDKKRKFTTKSKSNNWAPKYNETFHFLLGNEEGPESYE
LQICVKDYCFAREDRVLGLAVMPLRDVTAKGSCACWCPLGRKIHMDETGLTILRILSQRS
NDEVAREFVKLKSESRSTEEGS
NT seq 6009 nt NT seq  +upstreamnt  +downstreamnt
atgaagcgattgttgcaagagtcagaggaagaaatcatggttaccttgggaccctcctcc
aggctttccccagataaggctaaggcagagaccatgtgtggcaccaagagcaaatcctct
ggccctgctggatccttaccagaggacaactccctgcccccttgctgtgggtcagcagcc
ttagccattggtggagatagagatggggacctggcccagctttgcagctttgggcagcag
aacaacagccagcttcctctgggctccactgcctatgtttcagggtctggttctcaggat
ccctcatctgtcagcattaccacaagctgtcaggagccctcagagaggaaccaagccaag
acccttttgtccagaggccatggccaaggctgtagccgtgaacagcgggaacctttgggg
gatgtagtagaatacatcatcagagagctgcaaggcatcagccgtcttcagactgagatt
gctgagctgcagcagcacttgagccaagtccggggctccgtggatgaagtctctagctgt
gtagactcagtactgagtgaaatagaaggcttacaggtgagcagctgttccctggccaag
gtgtgtgagggggagaaggcccaggaaccccacgtggacagacccagtgaggaagccatt
ctgtatttgtacggacttcctgaacaagatggagaaaatactatggaactggtggaaagc
tttctagccaagcacctttgtgttaatggcatgcagtgcaacaggtacattaaaaaggct
tacagggcaggcacatccccttcccctaggcccactgttgtgaagcttgcccatctagag
catagagacttcatcttgcagaaatccatcctcttgcagaatgtgggagtccgaattgcc
accagagaagaaccaagctgcccacagggtaataagaatccccagaaggagtctatatca
ttttttcaacaacaacatcaggattatagtcagacttctttaaaccaggatgaaccagtt
cttcagatggaaacaggggacaggggacccataacaggaacatatcagatgaaggctcag
gatcaacagagagagcaccaggcccctgagcagcaaggcccttgctttctactcaagaac
aatttatcaaaggaaagtgatgtgcccaagctaggggatgaaataaaaggagcatcaaga
acatctcaagttatcagtggcagctgtgatgaactgtcagagaaaaaggcttctctgtct
accccccatcagtttgaggaacctgccctagtattaatctcaaaagaggaggcttctggg
aagtcccagtttttcaaacagtacagccaaaaacatgaagcatgtaaagtaggaaaacca
gaaaatgactgccacgataaaagtgaggccagcagctgcctgtcattgtctgggttactg
aagacagagagaataaacgcagaggacaagctcctgggctgcgaagctgggctcgatatt
ctgagctcaaaggaactagaggaccttttggcagacaagtccagaaggcttgcagctctg
agctgcgacagcatgatggaggaaattatcatagggcctgagactttcagtgacatggtt
catattgacctgaatgaagaggaggaatgtgctgctcatgtcctcaaggatgtctttgac
aagtcctcttgtgttctgggtggctctcaggaggatgaggatgtggaaatcaagttttat
acaagtaaactgggccgagcaattcaccactttcgttctgctctgcagggtgtgtttcag
aagctggagaacagtgggtccatcagtcctgaggacctggaaagcaatgagagtggttcc
cagtcagagaacagtgatcgacttcttgggacagtgagttcagggggtgcccaggattgc
tcactggagagccctgggagtcaggggagtgaaagcttgctcagtgtggtctctggtgga
gttggcgtctccacacagggagagcaaacccctcaggatccaagcaccttctctcttgct
tctaataactccttgccaagtgttgctctggctccatgtctgggaagtgagacttgttcc
aggcctggatctcccaagcaggacagactgagcctagagcaagtgtgtacagagaccgtt
tacctcaacaagtgcatcaacaattttaagaatgttctaagagagaaaagactaaggcag
aaaaaacttctgcatgagctagtacagaaagcaaaccatctctcagtagaagacatacac
tcagaagaaaagcgaggagcccttcagattccagatgatggtgacccctctctgcctcag
tggctcccggaagggccagccggagggctctatggcattgacagcatgccagatttacgc
agaaagaagccactgccacttgtcagtgatctggctatgtcactggtccagtctcggaag
gcaggaatcacttctgcaatggctacacgcacttctcttaaggacgaagagctgaaatcc
cacgtgtataagaaaaccctgcaggccttaatctaccccatttcgtgcaccactcctcat
aactttgaggtctggacggccactaccccaacctactgctatgagtgtgaaggcctgctc
tggggcattgcccggcagggcatgcgctgcagcgaatgtggagtcaagtgccatgagaag
tgccaggatctgctcaatgctgactgcctgcagcgtgacctgttgtgttcctggccacct
tcaggggctgcagaaaagagctgtaaacatggagctgaggaccggacccagaacattatc
atggccatgaaggaccgcatgaagatccgagagcgaaataagccagagatctttgaagtt
atccgggacgtcttcacagtgaacaaagctgcccatgtgcagcagatgaaaacagtgaag
cagagtgtactggatggcacctccaaatggtcagccaagatcaccattactgtggtgtgt
gcccagggcctacaagccaaggacaaaacaggatccagtgacccttacgtgactgtgcaa
gtcagcaaaactaagaagcgtaccaagaccatttttggaaacttgaatcctgtttgggag
gagaagttccattttgagtgccacaactcctctgaccgcattaaggtgcgtgtatgggat
gaggatgatgacatcaagtcaagagtaaagcaacgcctaaagcgagagtctgatgatttc
cttggccaaaccatcattgaggttcggaccctaagtggcgagatggacgtctggtacaac
ttggagaagaggacagacaaatcagccgtctcaggggctatccgactacaaatcagtgtg
gagatcaagggggaggagaaggtagccccataccacgtgcagtatacgtgtctccatgag
aatcttttccattacctcacagacattcagggcagtggaggagtccgcatccctgaagct
cgaggagacgatgcctggaaggtgtactttgatgagacagcccaagaaattgtggatgaa
tttgccatgcgttatggcattgagtccatatatcaggccatgacgcactttgcatgttta
tcatccaagtacatgtgtcctggtgtgccagcagtgatgagcaccttactggccaacatc
aatgcctactatgcccacacaactgcctctaccaatgtctctgcatctgatcgctttgca
gcctccaactttgggaaagagagatttgtaaaactgctggaccagctacacaactcactg
aggatcgacctctctacatacaggaataatttccctgctgggagtcctgaacggcttcag
gacttaaaatccacagtggatttgctgaccagcattactttcttcagaatgaaggtacaa
gaactgcaaagccctccaagagccagccaggtggtaaaggattgtgtgaaggcctgtttg
aactccacatatgaatatatcttcaacaactgccacgacttatacagccgccagtaccag
ctgaagcaggagctacctccagaggaacaagggcccagcattcggaacctggatttctgg
cccaagctcatcacactcatcgtgtcaatcatagaggaagataagaattcctacacacct
gttctgaaccagtttcctcaggagttgaatgtgggaaaagtcagcgcagaagtgatgtgg
catttgtttgcccaagacatgaaatatgcattggaggagcatgagaaagcccatctgtgt
aaaagtgctgactacatgaacctgcacttcaaggtgaagtggctccacaatgaatacgtg
cgggatctgcctgtcctccaggggcaggtgcctgagtacccagcgtggtttgaacagttc
gtgctacaatggctggatgagaatgaggatgtatccctggaattcctgcgtggggccctg
gaacgagataagaaggatggattccagcagacatcagagcatgcactcttttcctgctct
gtggtggatgtcttcacacaactcaatcagagctttgagatcatccggaagctggaatgc
ccagaccccagcatccttgcccactacatgaggaggtttgctaagaccatcgggaaagtg
ctgatgcagtatgcagacatcttgtcaaaggacttcccagcctattgcacaaaggagaaa
ctgccctgcatcctgatgaacaacatgcagcaactgagggtccagctggagaaaatgttt
gaggccatgggaggcaaggagctggaccttgaagctgcagacagtctgaaggagctgcag
gtgaaactgaatacggttctggatgagctcagcatggtgtttggaaacagtttccaggta
cggattgatgagtgtgttcgacaaatggccgacatcctgggccaggttcggggcacaggg
aatgcatctccagacgccagggcctcagcggctcaggatgcagatagcgtactccggcct
ctcatggacttcctggatggcaacctcaccctctttgccactgtgtgtgagaagacggtt
ctgaagcgtgtactgaaggagctctggcgcgtggtgatgaacacaatggagaggatgatt
gttctgcccccactcactgaccagacgggcacccagctgatcttcactgctgccaaggag
ctgagccatctttccaaactcaaggatcacatggtacgagaggaaacacggaatctcact
ccaaagcagtgtgcagtccttgacctcgccctggacaccatcaagcaatacttccatgca
ggaggcaatgggctgaagaaaaccttcctggagaagagcccagatctgcagtctctacgc
tatgccctgtctctgtacacacagactactgacactctcatcaagacctttgtgcgctcg
cagaccacccaagtgcatgatgggaaaggtattagatttactgctaatgaggacattcgt
ccggaaaaggggtctggtgtggacgatcctgtgggagaagtctctattcaggtggacttg
tttacacaccctggtactggggagcacaaggtcacagtgaaagtggtggctgccaatgac
ctcaagtggcagacagcgggtatgttccggcctttcgtggaggtgactatggttggccca
caccaaagtgataagaagaggaagttcacaaccaaatccaaaagcaacaactgggccccc
aagtacaatgagacattccacttcctcctgggaaatgaagaggggcccgagtcctatgag
ttgcagatatgcgtgaaggattactgctttgcccgggaagatcgcgtgctaggactggct
gtgatgcctctgagggatgtcacagccaagggcagctgtgcctgctggtgccccttgggc
cggaagatccatatggatgagacaggcctgaccattctccggattttgtctcagaggagc
aatgacgaggtggcccgagaatttgtgaaactcaaatcagagtctcgttccacggaggag
gggagctga

DBGET integrated database retrieval system