KEGG   Pan troglodytes (chimpanzee): 464188Help
Entry
464188            CDS       T01005                                 

Gene name
IMPAD1
Definition
inositol monophosphatase domain containing 1
Orthology
K15759  
inositol monophosphatase 3 [EC:3.1.3.25 3.1.3.7]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
Inositol phosphate metabolism
Sulfur metabolism
Metabolic pathways
Phosphatidylinositol signaling system
Module
Inositol phosphate metabolism, Ins(1,3,4,5)P4 => Ins(1,3,4)P3 => myo-inositol
Class
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:ptr00562]
Metabolism; Energy metabolism; Sulfur metabolism [PATH:ptr00920]
Environmental Information Processing; Signal transduction; Phosphatidylinositol signaling system [PATH:ptr04070]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
8
AA seq 359 aa AA seqDB search
MAPMGIRLSPLGVAVFCLLGLGVLYHLYSGFLAGRFSLFGLGGEPGGGAAGPAAAADGGT
VDLREMLAVSVLAAVRGGDEVRRVRESNVLHEKSKGKTREGAEDKMTSGDVLSNRKMFYL
LKTAFPSVQINTEEHVDAADQEVILWDHKIPEDILKEVTTPKEVPAESVTVWIDPLDATQ
EYTEDLRKYVTTMVCVAVNGKPMLGVIHKPFSEYTAWAMVDGGSNVKARSSYNEKTPRIV
VSRSHSGMVKQVALQTFGNQTTIIPAGGAGYKVLALLDVPDKSQEKADLYIHVTYIKKWD
ICAGNAILKALGGHMTTLSGEEISYTGSDGIEGGLLASIRMNHQALVRKLPDLEKTGHK
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atggcccccatgggcatccgcctttccccactgggggtggccgtgttttgcctgctgggg
ctcggcgtgctctaccacctctactcgggcttcttagctggccgcttcagcctcttcggc
ctgggcggcgagcctggcggcggcgcggcggggcccgcggccgcggccgacgggggcacc
gtggacttgcgcgagatgctggctgtgtcagtgctggccgcagttcgcggcggcgacgag
gtgaggcgcgtccgcgagagcaacgtcctccacgagaagtccaaggggaagacgcgcgag
ggagccgaggacaagatgaccagcggcgacgtgctgtccaaccgcaagatgttctacctg
ctcaagaccgccttccccagcgtccagattaatactgaggaacacgtggatgcagctgat
caggaggttatcttgtgggatcataagattcctgaggatatcctaaaggaagtaactact
cctaaagaggtaccagcagaaagtgttactgtctggattgacccacttgatgctacacag
gaatatacagaggatcttcgaaagtacgtcactactatggtgtgtgtggctgtaaatggt
aaacccatgctaggagttatacataagccattttccgaatatacagcttgggcaatggta
gatggtggttcaaatgtgaaagcccgctcttcctacaatgagaagaccccaaggatcgtt
gtgtctcgttcccattcagggatggtcaaacaggtcgctcttcagacttttggaaaccag
actacaattatcccagctggtggtgctggttataaagttttagcacttttggatgtgcct
gataagagtcaagaaaaagctgatttatatatccatgtgacatacatcaaaaagtgggat
atatgtgctggtaatgccatcttaaaagccctaggggggcatatgactaccctgagtggt
gaagaaatcagttacactggttcagacggcattgaagggggactccttgctagcatcaga
atgaaccaccaggccctggtcagaaaactcccagatctagaaaagacaggacataaatga

DBGET integrated database retrieval system