KEGG   Pan troglodytes (chimpanzee): 464454Help
Entry
464454            CDS       T01005                                 

Gene name
PLEC, PLEC1
Definition
plectin
Orthology
K10388  
plectin
Organism
ptr  Pan troglodytes (chimpanzee)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
8
AA seq 4541 aa AA seqDB search
MAGLLTSGPLPDEQDFIQAYEEVREKYKDERDRVQKKTFTKWVNKHLIKAQRHISDLYED
LRDGHNLISLLEVLSGDSLPREKGRMRFHKLQNVQIALDYLRHRQVKLVNIRNDDIADGN
PKLTLGLIWTIILHFQISDIQVSGQSEDMTAKEKLLLWSQRMVEGYQGLRCDNFTSSWRD
GRLFNAIIHRHKPLLIDMNKVYRQTNLENLDQAFSVAERDLGVTRLLDPEDVDVPQPDEK
SIITYVSSLYDAMPRVPDVQDGVRANELQLRWQEYRELVLLLLQWMRHHTAAFEERRFPS
SFEEIEILWSQFLKFKEMELPAKEADKNRSKGIYQSLEGAVQAGQLKVPPGYHPLDVEKE
WGKLHVAILEREKQLRSEFERWVGLECLQRIVTKLQMEAGLCEEQLNQADALLQSDVRLL
AAGKVPQRAGEVERDLDKADSMIRLLFNDVQTLKDGRHPQGEQMYRRVYRLHERLVAIRT
EYNLRLKAGMAAPATQVTQVTLQSVQRRPELEDSTLRYLQDLLAWVEENQHRVDGAEWGV
DLPSVEAQLGSHRGLHQSIEEFRAKIERARSDEGQLSPATRGAYRDCLGRLDLQYAKLLN
SSKARLRSLESLHSFVAAATKELMWLNEKEEEEVGFDWSDRNTNMTAKKESYSALMRELE
LKEKKIKELQNAGDRLLREDHPARPTVESFQAALQTQWSWMLQLCCCIEAHLKENAAYFQ
FFSDVREAEGQLQKLQEALRRKYSCDRSATVTRLEDLLQDAQDEKEQLNEYKGHLSGLAK
RAKAIVQLKPRHPAHPMRGRLPLLAVCDYKQVEVTVHKGDECQLVGPAQPSHWKVLSSSG
SEAAVPSVCFLVPPPNQEAQEAVTRLEAQHQALVTLWHQLHVDMKSLLAWQSLRRDVQLI
RSWSLATFRTLKPEEQRQALHSLELHYQAFLRDSQDAGGFGPEDRLMAEREYGSCSHHYQ
QLLQSLEQGAQEESRCQRCISELKDIRLQLEACETRTVHRLRLPLDKEPARECAQRIAEQ
QKAQAEVEGLGKGVARLSAEAEKVLALPEPSPAAPTLRSELELTLGKLEQVRSLSAIYLE
KLKTISLVIRSTQGAEEVLGAHEEQLKEAQAVPATLPELEATKASLKKLRAQAEAQQPTF
DALRDELRGAQEVGERLQQRHGERDVEVERWRERVAQLLERWQAVLAQTDVRQRELEQLG
RQLRYYRESADPLGAWLRDARRRQEQIQAMPLADSQAVREQLRQEQALLEEIERHGERVE
ECQSFAKQYINAIKDYELQLVTYKAQLEPVASPAKKPKVQSGSESVIQEYVDLRTRYSEL
TTLTSQYIKFISETLRRMEEEERLAEQQRAEERERLAEVEAALEKQRQLAEAHAQAKAQA
EREAKELQQRMQEEVVRREEAAVDAQQQKRSIQEELQQLRQSSEAEIQAKARQAEAAERS
RLRIEEEIRVVRLQLEATERQRGGAEGELQALRARAEEAEAQKRQAQEEAERLRRQVQDE
SQRKRQAEAELASRVKAEAEAAREKQRALQALEELRLQAEEAERRLRQAEVERARQVQVA
LETAQRSAEAELQSKRASFAEKTAQLERSLQEEHVAVAQLREEAERRAQQQAEAERAREE
AERELERWQLKANEALRLRLQAEEVAQQKSLAQAEAEKQKEEAEREARRRGKAEEQAVRQ
RELAEQELEKQRQLAEGTAQQRLAAEQELIRLRAETEQGEQQRQLLEEELARLQREAAAA
TQKRQELEAELAKVRAEMEVLLASKARAEEESRSTSEKSKQRLEAEAGRFRELAEEAARL
RALAEEAKRQRQLAEEDAARQRAEAERVLAEKLAAISEATRLKTEAEIALKEKEAENERL
RRLAEDEAFQRRRLEEQAAQHKADIEERLAQLRKASDSELERQKGLVEDTLRQRRQVEEE
ILALKASFEKAAAGKAELELELGRIRSNAEDTLRSKEQAELEAARQRQLAAEEEQRRREA
EERVQKSLAAEEEAARQRKAALEEVERLKAKVEEARRLRERAEQESARQLQLAQEAAQKR
LQAEEKAHAFAVQQKEQELQQTLQQEQSVLDRLRSEAEAARRAAEEAEEARVQAEREAAQ
SRRQVEEAERLKQSAEEQAQARAQAQAAAEKLRKEAEQEAARRAQAEQAALRQKQAADAE
MEKHKKFAEQTLRQKAQVEQELTTLRLQLEETDHQKNLLDEELQRLKAEATEAARQRSQV
EEQLFSVRVQMEELSKLKARIEAENRALILRDKDNTQRFLQEEAEKMKQVAEEAARLSVA
AQEAARLRQLAEEDLAQQRALAEKMLKEKMQAVQEATRLKAEAELLQQQKELAQEQARRL
QEDKEQMAQQLAEETQGFQRTLEAERQRQLEMSAEAERLKLRVAEMSRAQARAEEDAQRF
RKQAEEIGEKLHRTELATQEKVTLVQTLEIQRQQSDHDAERLREAIAELEHEKEKLQQEA
KLLQLKSEEMQTVQQEQLLQETQALQQSFLSEKDSLLQRERFIEQEKAKLEQLFQDEVAK
AQQLREEQQRQQQQMEQERQRLVASMEEARRRQHEAEEGVRRKQEELQQLEQQRRQQEEL
LAEENQRLREQLQRLEEQHRAALAHSEEVTASQVAATKTLPNGRDALDGPAAEAEPEHSF
DGLRRKVPAQRLQEAGILSAEELQRLAQGHTTVDELARREDVRHYLRGRSSIAGLLLKPT
NEKLSVYAALQRQLLSPGTALILLEAQAASGFLLDPVRNRRLTVNEAVKEGVVGPELHHK
LLSAERAVTGYKDPYTGQQISLFQAMQKGLIVREHGIRLLEAQIATGGVIDPVHSHRVPV
EVAYRRGYFDEEMNRILADPSDDTKGFFDPNTHENLTYLQLLERCVEDPETGLRLLPLTD
KAAKGGELVYTDSEARDVFEKATVSAPFGKFQGKTVTIWEIINSEYFTAEQRRDLLRQFR
TGRITVEKIIKIIITVVEEQEQKGRLCFEGLRSLVPAAELLESRVIDRELYQQLQRGERS
VREVAEVDTVRRALRGANVIAGVWLEEAGQKLSIYNALKKDLLPSDMAVALLEAQAGTGH
IIDPATSARLTVDEAVRAGLVGPEFHEKLLSAEKAVTGYRDPYTGQSVSLFQALKKGLIP
REQGLRLLDAQLSTGGVVDPSKSHRVPLDVACARGCLDEETSRALSAPRADAKAYSDPST
GEPVTYGELQQRCRPDQLTGLSLLPLSEKAARARQEELYSELQARETFEKTPVEVPVGGF
KGRTVTVWELISSEYFTAEQRQELLRQFRTGKVTVEKVIKILITIVEEVETLRQERLSFS
GLRAPVPASELLASGVLSRAQFEQLKDGKTTVKDLSELGSVRTLLQGSGCLAGIYLEDTK
EKVSIYEAMRRGLLRASTAALLLEAQAATGFLMDPVRNQRLYVHEAVKAGVVGPELHEQL
LSAEKAVTGYRDPYSGSTISLFQAMQKGLVLRQHGIRLLEAQIATGGIIDPVHSHRVPVD
VAYQRGYFNEEMNRVLADPSDDTKGFFDPNTHENLTYRQLLERCVEDPETGLRLLPLKGA
EKAEVVETTQVYTEEETRRAFEETQIDIPGGGSHGGSTMSLWEVMQSDLIPEEQRAQLMA
DFQAGRVTKERMIIIIIEIIEKTEIIRQQGLASYDYVRRRLTAEDLFEARIISLETYNLL
REGTRSLREALEAESAWHYLYGTGSVAGVYLPGSRQTLSIYQALKKGLLSAEVARLLLEA
QAATGFLLDPVKGERLTVDEAVRKGLVGPELHDRLLSAERAVTGYRDPYTEQTISLFQAM
KKELIPNEEALRLLDAQLATGGIVDPRLGFHLPLEVAYQRGYLNKDTHDQLSEPSEVRSY
VDPSTDERLSYTQLLRRCRRDDSTGQLLLPLSDARKLTFRGLRKQITVEELVRSQVMDEA
TALQLREGLTSIEEVTKNLQKFLEGTSCIAGVFVDATKERLSVYQAMKKGIIRPGTAFEL
LEAQAATGYVIDPIKGLKLTVEEAVRMGIVGPEFKDKLLSAERAVTGYKDPYSGKLISLF
QAMKKGLILKDHGIRLLEAQIATGGIIDPEESHRLPVEVAYKRGLFDEEMNEILTDPSDD
TKGFFDPNTEENLTYLQLMERCITDPQTGLCLLPLKEKKRERKTSSKSSVRKRRVVIVDP
ETGKEMSVYEAYRKGLIDHQTYLELSEQECEWEEITISSSDGVVKSMIIDRRSGRQYDID
DAIAKNLIDRSALDQYRAGTLSITEFADMLSGNAGGFRSRSSSVGSSSSYPISPAVSRTQ
LASWSDPTEETGPVAGILDTETLEKVSITEAMHRNLVDNITGQRLLEAQACTGGIIDPST
GERFPVTDAVNKGLVDKIMVDRINLAQKAFCGFEDPRTKTKMSAAQALKKGWLYYEAGQR
FLEVQYLTGGLIEPDTPGRVPLDEALQRGTVDARTAQKLRDVGAYSKYLTCPKTKLKISY
KDALDRSMVEEGTGLRLLEAAAQSTKGYYSPYSVSGSGSTTGSRTGSRTGSRAGSRRGSF
DATGSGFSMTFSSSSYSSSGYGRRYASGSSASLGGHESAVA
NT seq 13626 nt NT seq  +upstreamnt  +downstreamnt
atggccggcctgctgacgtccggcccgctgcccgacgagcaggacttcatccaggcctac
gaggaggtgcgcgagaagtacaaagatgagcgggatcgtgtgcagaagaaaaccttcacc
aagtgggtcaacaagcacctcatcaaggcccagagacacatcagtgacctgtatgaagac
ctccgcgatggccacaacctcatctccctgctggaggtcctctcgggggacagcctgccc
cgggagaaggggaggatgcgtttccacaagctgcagaatgtccagattgccctggactac
ctccggcaccgccaggtgaagctggtgaacatcaggaatgatgacatcgccgacggcaac
cccaagctgacccttggcctcatctggacaatcattctgcacttccagatctcagatatc
caggtgagtgggcagtcggaggacatgacggccaaggagaagctgctgctgtggtcgcag
cgcatggtggaggggtaccagggcctgcgatgcgacaacttcacctccagctggagagac
ggccgcctcttcaatgccatcatccaccggcacaagcccctgctcatcgacatgaacaag
gtgtaccggcagaccaacctggagaacctggaccaggccttctctgtggcggagcgggac
ctgggagtgacgcggctcctggaccctgaggacgtggatgtccctcagcccgacgagaag
tccatcatcacctacgtctcgtcgctgtatgacgccatgccccgcgtgccggacgtgcag
gatggggtgagggccaacgagctgcagctacgctggcaggagtaccgggagctggtgctg
ctgctgcttcagtggatgcgacaccacaccgccgcctttgaggaacgcaggttcccctcc
agcttcgaggagattgagatcctgtggtctcagttcttgaagtttaaggagatggagcta
ccagccaaggaggccgacaagaacaggtccaagggcatctaccaatccctggagggagcg
gtgcaagcaggccagctcaaggtgccccctggctaccacccgctggacgtggagaaagag
tggggcaagctgcacgtggccatcctggagcgggagaagcagctccgcagcgagtttgag
aggtgggtggggctggagtgtcttcagcgcatcgtgaccaagctgcagatggaggcgggg
ctgtgtgaggagcagctgaaccaggccgacgccctgctgcagtcggatgtccggctgctg
gccgcaggcaaagtgccacagcgggcgggggaggtggaacgggacttggacaaggcggat
agcatgatccggctgctgttcaacgacgtgcagaccctcaaggatggacggcacccgcag
ggcgagcagatgtaccgcagggtgtaccgtctgcacgagcgcctggtagccatccgcacc
gagtacaacctacggctgaaggcaggcatggcggcccctgcaacccaggtgacccaggtg
actctgcagagtgtgcagaggcgccccgagctggaggactccactctgcgctacctgcag
gacctcctggcctgggtggaggagaaccagcaccgtgtggatggcgctgagtggggtgtg
gacctgcccagcgtggaggcgcagctgggcagccaccgaggcctgcaccagtccatcgaa
gaattccgggccaagatcgagcgggcacggagtgacgagggccagctctcccctgccacc
cggggtgcctaccgtgactgcctgggtcggctggacctacagtacgccaagctgctgaac
tcctccaaggcccgcctcaggtccctggagagcttgcacagctttgtggcagccgccact
aaggagctaatgtggctgaatgagaaggaggaggaggaggtgggcttcgactggagcgac
cgcaacaccaacatgaccgccaagaaggagagctactcggcgctgatgcgggagctggag
ctgaaggagaagaagatcaaggagctccaaaatgctggggaccggttgctgcgggaggac
cacccggcccggcccacggtggagtccttccaggcggccctgcagacacagtggagctgg
atgctacagctgtgctgctgtatcgaggcacacctgaaggagaacgctgcctactttcag
ttcttctcagatgtgcgggaggccgaggggcagttgcagaagctgcaggaggcactgcgt
aggaaatacagttgtgatcgctccgccaccgtcacccggctggaggacctgctgcaggat
gcccaggacgagaaggaacagctgaacgagtacaagggccacctctcaggcctggccaag
cgggccaaggccatcgtgcagctgaagccccgccacccagcccaccccatgcggggccgc
ctgcccctgctggccgtgtgcgactataagcaggtggaggtgactgtgcacaagggtgac
gagtgccagctggtgggccctgcacagccgtcccactggaaggtgctcagcagctccggc
agcgaggccgccgtgccctccgtgtgcttcctggtgcccccgcccaaccaggaggcccag
gaggctgtcaccaggctggaggcccagcaccaggccctggtcacgctgtggcaccagttg
cacgtggacatgaagagccttctggcctggcagagccttcgccgcgacgtgcagctcatc
cgctcctggtccctggccacgttccgcaccctgaagccagaggagcagcgccaagccctg
cacagcctggagctgcactaccaggccttcctgcgggacagccaggacgcgggcggcttc
ggacccgaggaccggctgatggccgagcgcgagtacggctcctgcagccaccactaccag
cagctgctgcagagcctggagcagggtgcacaggaagagtctcgctgccagcgctgcatc
tccgagctcaaagacatccggctgcagctggaggcctgtgagacacgcaccgtgcaccgc
ctgcggctgccgctggacaaagagccagcacgggagtgtgcccagcgcatcgccgagcag
cagaaggcacaggcagaggtggaggggctgggcaagggggtcgcccggctctctgccgag
gccgagaaggtcttggccctgccagagccatcgcctgcggcccccacgctgcgctcggag
ctggagctgacgctgggcaagctggagcaggtccgcagcctgtctgccatctacctggag
aagctcaagaccatcagcctggtgatccgcagcacgcagggggccgaggaggtgctcggg
gcccacgaggagcagctcaaggaggcccaggccgtgccggccaccctcccggagctcgag
gccaccaaggcctctctgaagaagctgcgggcccaggccgaggcacagcagcccacgttc
gacgccctgcgggatgagctgcggggggcgcaggaggtgggggagcgactgcagcagcgg
cacggggagcgggacgtggaggtagagcgctggcgggagcgggtcgcccagctgcttgag
cgctggcaggctgtgctggcccagaccgacgtgcggcagcgcgagctcgagcaactgggc
cgccagctgcgttactaccgcgagagcgcagaccccttgggcgcctggctgcgggacgcc
aggcggcggcaggagcagatccaggccatgccgctggccgacagccaggctgtgcgggag
cagctgcggcaggagcaggccctgctggaggagatcgagcgccacggcgagagggtcgag
gagtgccagagctttgcgaaacagtacatcaacgccatcaaggactatgaactccagctg
gtgacgtacaaggcgcagcttgagccggtggcctccccggccaagaagcccaaggtccag
tcgggatcagagagtgtcatccaggagtacgtggacctgcgtacgcgctacagcgagctg
accacactgacgagccagtacatcaagttcatcagcgagactctgcggcgcatggaggag
gaggagaggctggctgagcagcagcgggcagaggagcgcgagcggctggccgaggtggag
gccgcgctggagaagcagcggcagctggccgaggcacacgcccaggcaaaggcacaggcg
gagcgggaggcgaaggagctgcagcagcgcatgcaggaggaggtggtgcggcgggaggag
gcggcggtggacgcgcagcagcagaagcgcagcattcaggaggagctgcagcagctgcgg
cagagctcggaggcggagatccaggccaaggcccggcaggcagaggcggctgagcgcagc
cggctgcgcatcgaggaggagatccgcgtggtgcgcctgcagctggaggccaccgagcgc
cagcgtggcggggccgagggggagctgcaggcactgcgtgcacgggcggaggaggcggag
gcacaaaagcgacaggcgcaggaggaggccgagcgcttgcggaggcaggtgcaggacgag
agccagcgtaagcggcaggcggaggcggagctggcctcgcgcgtgaaggccgaggccgag
gcggcgcgtgagaagcagcgggccctgcaggccctggaggagctgcggctgcaggcggag
gaggcagagcggcgcctgcggcaggccgaggtggagcgggcgcggcaggtacaggtggcc
ctggagacggcgcagcgcagtgcagaggcggagctgcagagcaaacgcgcctctttcgcc
gagaagacggcacagctggagcgctccctgcaggaggaacacgtggctgtggcacagctg
cgggaggaggctgagcggcgggcacagcagcaggccgaggccgagcgggcacgcgaggag
gcagagcgggagctggagcgctggcagctcaaggccaatgaggcgctacggctgcggctg
caggcggaggaggtggcgcagcagaagagcctggcgcaggccgaggctgagaagcagaag
gaggaggcggagcgcgaggcgcggcggcgcggcaaggcagaggagcaggccgtccggcag
cgggagctggctgaacaagagctggagaagcagcggcagctggcggaaggcaccgcgcag
cagcgcctggccgcggagcaggagttgatccggctgcgggctgagacggagcagggggag
cagcagcggcagctgctggaggaggagctggcccggctgcagcgtgaggcggctgcagcc
acgcagaaacggcaggagctggaagccgagctggccaaggtgcgggccgagatggaggtg
ctgctggccagcaaggcgagggctgaggaagagtcgcgctccaccagcgagaagtccaag
cagaggctggaggccgaggccggccggttccgcgagctggccgaggaggccgcccgcctg
cgtgccctggcggaagaggccaagcggcagcggcagctggccgaggaagacgcggcgcgg
cagcgggccgaggcggagcgggtgcttgcggagaagctggccgccatcagcgaggccacg
cggctcaagacggaggcagagatcgcgctcaaggagaaggaggcagagaatgagcgcctg
cggcggctggcggaggacgaggccttccagcggcggcggctggaggagcaggccgcgcaa
cacaaggcggacattgaggagcgcctggcccagctgcgcaaggcgtcggacagcgagctg
gagcggcagaaggggctggtggaggacacgctgaggcagcggcggcaggtggaggaggag
atcctggcgctgaaggcgagcttcgagaaggcggccgctggcaaggcggagctggagctg
gagctgggacgcatccgcagcaacgcggaggacacactgcgcagcaaggagcaggccgag
ctggaggccgcgaggcagcggcagctggcggcggaggaggagcagcggcgccgtgaggct
gaggagcgcgtgcagaagagcctggcggccgaggaggaggcagcacggcagcggaaggcg
gcgctggaggaagtcgagaggctgaaagccaaggtggaggaggcgcggcgcctgcgggag
cgagcagagcaggagtcggcgcggcagctgcagctggcccaggaggccgctcagaagcgg
ctgcaggcagaagagaaggcgcacgccttcgcggtgcagcagaaggagcaggagctacag
cagacgttgcagcaggagcagagcgtgctggaccggctgcgcagcgaggcggaggcggcc
cggcgggcggctgaggaggcggaggaggcccgggtgcaggcggagcgtgaggcggcgcag
tcccggcggcaggtggaagaggccgagcggctgaagcagtcggcagaggagcaggcacag
gcccgggctcaggcgcaggcggctgcggagaagctgcgcaaggaggctgagcaagaggcg
gcgcggcgggcacaggcggagcaggcggccctgcggcagaagcaggcagctgacgcggag
atggagaagcataagaaattcgccgagcagacgctgcggcagaaggcgcaggtggagcag
gagctgacaacactgcggctgcagctggaggagaccgaccaccagaagaacctgctggac
gaggagctgcagcggctgaaggcggaggccacggaggccgcacgccagcgcagccaggtg
gaggagcagctcttctccgtgcgcgtgcagatggaggagctgagcaagctcaaggcacgc
atcgaggctgagaaccgcgcactcatcttgcgcgacaaggacaatacgcagcgcttcctg
caggaggaggctgagaagatgaagcaggtggcggaggaggccgcgcggctgagtgtggcg
gcccaggaggccgcgcggctgcggcagctggcagaggaggacctggcacagcagcgggcc
ttggcagagaagatgctcaaggagaagatgcaggcggtgcaggaggccacgcgactcaag
gctgaggcggaactgctgcagcagcagaaggagcttgcgcaggagcaggcgcggcggctg
caggaggacaaggagcagatggcgcagcagctggcggaggagacgcagggcttccagcgg
acgctggaggccgagcggcagcggcagctggagatgagcgctgaggctgagcgcctcaag
ctgcgtgtggccgagatgagccgagcccaggcccgcgctgaggaggacgcccagcgcttc
cggaagcaggcggaggagatcggtgagaagctgcaccgcacggagctcgccacgcaggag
aaggtgaccctggtgcagacactggagatccagcgacagcagagtgaccatgatgccgag
cgcctgcgggaggccatcgctgagctggagcatgagaaggagaagctccaacaggaggcc
aaactgctgcagctcaagtctgaggagatgcagacggtgcagcaggagcagctgctgcag
gagacgcaggccctgcagcaaagcttcctctctgaaaaggacagcctgctacagcgggag
cgcttcatcgagcaggagaaggccaagctggagcagctcttccaggacgaggtggccaag
gcacagcagctgcgtgaggagcagcagcggcagcagcagcagatggagcaggaacggcag
cggctggtggccagcatggaggaggcgcggcggcggcagcatgaggcagaggagggcgtg
cggcgcaagcaggaggagctgcagcagctggagcagcagcggcggcagcaggaggagctg
ctggctgaggagaaccagaggctgcgtgagcagctgcagcgcctggaggagcagcaccgg
gccgcgctggcgcactcagaggaggtcactgcctcgcaggtggctgccacgaagaccctg
cccaatggccgggatgcacttgatggccccgcggcagaggcagagccggagcacagcttc
gatggcctgcggcggaaggtgccagcccagaggctgcaggaggccggcatcctgagtgcg
gaggagctgcagcggttggcacagggccacaccacggtggacgagctcgcacggcgggaa
gacgtgcgccactacctgaggggccgcagcagtatcgcagggctgttgctgaagcccacc
aatgagaagctgagtgtttacgccgccctgcagaggcagctgctgagtcccggcacggcc
ctcatcctgctggaggcgcaggcggcctcaggcttcctgctggaccctgtgcggaaccgg
cggctgaccgtcaacgaggctgtgaaggagggtgtggtgggccccgagctgcaccacaag
ctgctgtcggccgagcgcgccgtcactggctacaaggacccctacactggccagcagatc
tctctcttccaagccatgcagaagggcctcatcgtccgggagcacggcatccgcctgctg
gaggcccagatcgccacgggcggcgtcatcgaccccgtgcacagccaccgcgtgcccgtg
gaggtggcctaccggcgcggctacttcgacgaggagatgaaccgcatcctggcggacccc
agcgacgacaccaagggcttcttcgaccccaacacgcacgagaacctcacgtacctgcag
ctactggagcgctgcgtggaggaccccgagacgggcctgcgccttctgccactcacggat
aaggctgccaagggcggggagctggtctacactgactccgaggcccgggacgtctttgag
aaggccaccgtgtccgcgccgtttggcaagttccagggcaagacggtgaccatttgggag
atcatcaactcggaatacttcacggcagagcagcggcgggacctgctgcggcagttccgc
acgggccggatcacagtggagaagatcatcaagatcatcatcacggtggtggaggagcag
gagcagaagggccggctttgctttgagggcctgcgcagcctggtgccagccgccgagctg
ctggagagcagggtcatcgaccgcgagctctaccagcagctgcagcgaggtgagcgctct
gtgcgagaggtggccgaggtggacactgtgcgacgggctctccggggtgccaacgtcatc
gcgggtgtatggctggaggaggcggggcagaagctgagtatctacaatgccctgaagaaa
gacctgctgccgtccgacatggccgtggccctgttggaagcccaggccggcaccgggcac
atcatcgaccccgccaccagcgcccggctgaccgtggacgaggcagtgcgtgctggcctg
gtgggccccgagtttcatgagaagctgctatcagccgagaaggctgtgacagggtacagg
gacccctacacagggcagagcgtctccctgttccaggccctgaagaagggcctcattccc
cgggagcagggcctgcgcctgttggacgcccagctgtccacgggcggcgtcgtggacccc
agcaagagccaccgcgtgcccctggatgtcgcctgcgcccgaggctgcctggatgaggag
accagcagggccctgtcggcaccaagggccgacgccaaggcctacagtgaccctagcaca
ggggagccggtcacctacggcgagctccagcagcggtgccggcccgaccagctgaccggg
ctgagcctgctgccgctctcagaaaaggctgctcgggcccggcaggaggagctctactca
gagctgcaggcccgtgagacctttgaaaagaccccggttgaggtccccgtgggtggcttc
aagggcaggacggtgacggtgtgggagctcatcagctctgagtacttcactgcggagcag
cggcaggagctgttgcgtcagttccgcacgggcaaggtcaccgtggagaaggtcatcaag
atcctcattaccatcgtggaggaggtggagaccctgcggcaggagaggctgtccttcagc
ggcctccgtgcccctgtgccagccagcgagctcctggcttccggggtcctcagcagagcc
cagtttgagcagctcaaggacggcaagacgacggtcaaggacctttcggagctgggctcc
gtgcggacgctgctgcagggcagtggctgcctcgccggcatctacctggaggacaccaag
gagaaggtgtccatctacgaggccatgcgccggggcctgctgagagccagcacggctgcg
ctcctgctggaggcgcaggcggccactggcttcctgatggaccccgtgcggaaccagcgc
ctgtacgtccacgaggccgtgaaggcgggcgtggtgggccccgagcttcacgagcagctg
ctgtctgccgagaaggccgtcaccggctacagagacccctactcgggcagcaccatctct
ctcttccaggccatgcagaagggcctggttctccggcagcatggcatccgcctgctggag
gcccagatcgccacgggtggcatcatcgaccccgtgcacagccaccgtgtgcctgtggac
gtggcctaccagcgcggctacttcaatgaggagatgaaccgcgtcttggcggaccccagc
gatgacaccaagggcttctttgaccccaacacgcatgagaacctcacgtacaggcagctg
ctggagcggtgcgtggaggaccccgagacgggcctgcgccttctgccactgaaaggggcg
gagaaggctgaggtggtggagaccacgcaggtgtacactgaggaggagacaagaagggca
tttgaagagacacagattgacattcccggcggcggcagccacggcggctccaccatgtcc
ctgtgggaggtgatgcagtcggacctgatccccgaggagcagcgggcccagctgatggct
gacttccaggccggccgggtgaccaaggaacgcatgatcatcatcatcatcgagatcatt
gagaagacagagatcatccgccagcagggtctggcctcctacgactacgtgcgccgccgc
ctcacggctgaggacctgttcgaggctcggatcatctctctcgagacctacaacctgctc
cgggagggcaccaggagcctccgtgaggctctcgaggcggagtccgcctggcactacctc
tatggcacgggctccgtggccggtgtctacctgcccggttccaggcagacactgagcatc
taccaggccctcaagaaagggctgctgagtgccgaggtggcccgcctgctgctggaggca
caggcagccacaggcttcctgctggacccggtgaagggggagcggctgactgtggatgag
gctgtgcggaagggcctggtggggcccgagctgcacgaccgcctgctctcggctgagcgg
gcggtcaccggctaccgcgacccctacaccgagcagaccatctcgctcttccaggccatg
aagaaggagctgatccctaatgaggaggccctgcggctgctggatgcccagctggccacc
ggcggcatcgtggacccccgcctgggcttccaccttcccctggaggtggcttaccagcgc
ggctacctcaacaaggacacgcacgaccagctgtcagagcccagcgaggtgcgcagctac
gtggacccgtccaccgacgagcgcctcagctacacgcagctgctcaggcggtgccgtcgt
gacgacagcaccggccagctgctcctgccgctgtcggacgcccgcaagctgaccttccgc
ggcctgcggaagcagatcaccgtggaggagctggtgcgctcgcaggtcatggacgaggcc
acggcgctgcagctgcgggagggcctgacctccatcgaggaggtcaccaagaacttgcag
aagttcctggaaggcaccagctgcatcgctggtgtcttcgtggacgccaccaaggaacgg
ctctcggtgtaccaggccatgaagaagggcatcatccgccccggcacggcctttgagctc
ctggaggcgcaggcggccaccggttacgtcatcgaccccatcaagggactgaagctgacg
gtggaggaggctgtgcgtatgggcatcgtgggccccgagttcaaggacaagctgctgtcg
gccgagcgcgccgtcactgggtacaaggacccctactctgggaagctcatctccctcttc
caggccatgaagaagggcctgatcctgaaggaccacggcatccgcctgctggaggcccag
atcgccacgggcggcatcatcgaccctgaggagagccaccggctgcccgtggaggtggcc
tacaagcgcggcctcttcgatgaggagatgaacgagatcctgaccgacccctcggacgac
accaagggcttctttgaccctaacacggaggagaacctcacctacctgcagctgatggag
cgttgtatcaccgacccccagacgggcctgtgtctcctgccgctgaaggagaagaagcgg
gaacggaagacctcctccaagtcctccgtgcgcaagcgccgagtggtcatcgtggacccc
gagacgggcaaggagatgtccgtgtacgaggcctaccgcaagggcctgatcgaccaccag
acgtacctggagctgtccgagcaggagtgcgagtgggaggagatcaccatctcctcctcg
gacggcgtggtcaagtccatgatcatcgaccgccgctccgggcgccagtacgacatcgat
gacgccatcgccaagaacctcatcgaccgctcggcactggaccagtaccgcgccggcacg
ctctccatcaccgagttcgccgacatgctctcgggcaacgccggtggcttccgctcccgt
tcctcctcggtgggatcctcctcctcctaccccatcagccccgccgtctccaggacccag
ctggcctcctggtcggaccccactgaggagacgggccccgtggctggcatcctggacacg
gagacgctggagaaggtgtccatcaccgaggccatgcaccggaacctggtggataacatc
acgggacagcggctgctggaggcgcaggcctgcactgggggcatcatcgaccccagcacc
ggtgagcgcttccctgtcaccgacgccgtcaacaagggcctggtggacaagatcatggtg
gaccgcatcaacctggcccagaaggccttctgcggcttcgaggacccacgcaccaagacc
aagatgtcggccgcccaggccctgaagaagggctggctctactacgaggccggccagcgc
ttcctggaggtgcagtacctgaccggcggcctgatcgagcccgacacgccgggccgcgtg
cccctggacgaggccctgcagcgcggcacggtggacgcccgcaccgcccagaagctgcgt
gacgtgggcgcctactccaagtacctcacctgccctaagaccaagctcaagatctcctat
aaggacgcgctggaccgcagcatggtggaggagggcacggggctgcggctgctggaggct
gccgcgcagtccaccaagggctactacagcccctacagcgtcagcggctccggctctacc
accggctcccgcactggctcgcgcaccggctcccgggccggctcccgccgcggcagcttt
gacgccaccggctccggcttctccatgaccttctcttcatcctcctactcctcctcgggc
tacggccgccgctacgcctcggggtcctcggcctccctggggggccatgagtctgccgtg
gcctga

DBGET integrated database retrieval system