KEGG   Pan troglodytes (chimpanzee): 464496Help
Entry
464496            CDS       T01005                                 

Gene name
PBK
Definition
PDZ binding kinase (EC:2.7.11.1)
Orthology
K08865  
PDZ-binding kinase [EC:2.7.12.2]
Organism
ptr  Pan troglodytes (chimpanzee)
Brite
Enzymes [BR:ptr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     464496 (PBK)
Protein kinases [BR:ptr01001]
 Serine/threonine protein kinases: Other group
  TOPK family
   464496 (PBK)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
8
AA seq 322 aa AA seqDB search
MEGISNFKTPSKLSEKKKSVLCSTPTINIPASPFMQKLGFGTGVNVYLMKRSPRGLSHSP
WAVKKINPICDDHYRSVYQKRLMDEAKILKSLHHPNIVGYRAFTEASDGSLCLAMEYGGE
KSLNDLIEERYKASQDPFPAAIILKVALNMARGLKYLHQEKKLLHGDIKSSNVVIKGDFE
TIKICDVGVSLPLDENMTVTDPEACYIGTEPWKPKEAVVENGVITDKADIFAFGLTLWEM
MTLSIPHINLSNDDDDEDKTFDESDFDDEAYYAALGTRPPINMEELDESYQKVIELFSVC
TNEDPKDRPSAAHIVEALETDV
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atggaagggatcagtaatttcaagacaccaagcaaattatcagaaaaaaagaaatctgta
ttatgttcaactccaactataaatatcccggcctctccatttatgcagaagcttggcttt
ggtactggggtaaatgtgtacctaatgaaaagatctccaagaggtttgtctcattctcct
tgggctgtaaaaaagattaatcctatatgtgatgatcattatcgaagtgtgtatcaaaag
agactaatggatgaagctaagattttgaaaagccttcatcatccaaacattgttggttat
cgtgcttttactgaagccagtgatggcagtctgtgtcttgctatggaatatggaggtgaa
aagtctctaaatgacttaatagaagaacgatataaagccagccaagatccttttccagca
gccataatcttaaaagttgctttgaatatggcaagagggttaaagtatctgcaccaagaa
aagaaactgcttcatggagacataaagtcttcaaatgttgtaattaaaggcgattttgaa
acaattaaaatctgtgatgtaggagtctctctaccactggatgaaaatatgactgtgact
gaccctgaggcttgttacattggcacagagccatggaaacccaaagaagctgtggtggag
aatggtgttattactgacaaggcagacatatttgcctttggccttactttgtgggaaatg
atgactttatcgattccacacattaatctttcaaatgatgatgatgatgaagataaaact
tttgatgaaagtgattttgatgatgaagcatactatgcagccttgggaactaggccacct
attaatatggaagaactggatgaatcataccagaaagtaattgaactcttctctgtatgc
actaatgaagaccctaaagatcgtccttctgctgcacacattgttgaagctctggaaaca
gatgtctag

DBGET integrated database retrieval system