KEGG   Pan troglodytes (chimpanzee): 464496Help
Entry
464496            CDS       T01005                                 

Gene name
PBK
Definition
PDZ binding kinase (EC:2.7.11.1)
Orthology
K08865  
PDZ-binding kinase [EC:2.7.12.2]
Organism
ptr  Pan troglodytes (chimpanzee)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
8
AA seq 322 aa AA seqDB search
MEGISNFKTPSKLSEKKKSVLCSTPTINIPASPFMQKLGFGTGVNVYLMKRSPRGLSHSP
WAVKKINPICDDHYRSVYQKRLMDEAKILKSLHHPNIVGYRAFTEASDGSLCLAMEYGGE
KSLNDLIEERYKASQDPFPAAIILKVALNMARGLKYLHQEKKLLHGDIKSSNVVIKGDFE
TIKICDVGVSLPLDENMTVTDPEACYIGTEPWKPKEAVVENGVITDKADIFAFGLTLWEM
MTLSIPHINLSNDDDDEDKTFDESDFDDEAYYAALGTRPPINMEELDESYQKVIELFSVC
TNEDPKDRPSAAHIVEALETDV
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atggaagggatcagtaatttcaagacaccaagcaaattatcagaaaaaaagaaatctgta
ttatgttcaactccaactataaatatcccggcctctccatttatgcagaagcttggcttt
ggtactggggtaaatgtgtacctaatgaaaagatctccaagaggtttgtctcattctcct
tgggctgtaaaaaagattaatcctatatgtgatgatcattatcgaagtgtgtatcaaaag
agactaatggatgaagctaagattttgaaaagccttcatcatccaaacattgttggttat
cgtgcttttactgaagccagtgatggcagtctgtgtcttgctatggaatatggaggtgaa
aagtctctaaatgacttaatagaagaacgatataaagccagccaagatccttttccagca
gccataatcttaaaagttgctttgaatatggcaagagggttaaagtatctgcaccaagaa
aagaaactgcttcatggagacataaagtcttcaaatgttgtaattaaaggcgattttgaa
acaattaaaatctgtgatgtaggagtctctctaccactggatgaaaatatgactgtgact
gaccctgaggcttgttacattggcacagagccatggaaacccaaagaagctgtggtggag
aatggtgttattactgacaaggcagacatatttgcctttggccttactttgtgggaaatg
atgactttatcgattccacacattaatctttcaaatgatgatgatgatgaagataaaact
tttgatgaaagtgattttgatgatgaagcatactatgcagccttgggaactaggccacct
attaatatggaagaactggatgaatcataccagaaagtaattgaactcttctctgtatgc
actaatgaagaccctaaagatcgtccttctgctgcacacattgttgaagctctggaaaca
gatgtctag

DBGET integrated database retrieval system