KEGG   Pan troglodytes (chimpanzee): 464586Help
Entry
464586            CDS       T01005                                 

Gene name
SYK
Definition
(RefSeq) spleen associated tyrosine kinase
  KO
K05855  
spleen tyrosine kinase [EC:2.7.10.2]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
NF-kappa B signaling pathway
Phospholipase D signaling pathway
PI3K-Akt signaling pathway
Osteoclast differentiation
Platelet activation
Natural killer cell mediated cytotoxicity
B cell receptor signaling pathway
Fc epsilon RI signaling pathway
Fc gamma R-mediated phagocytosis
Tuberculosis
Epstein-Barr virus infection
Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:ptr00001]
 Environmental Information Processing
  Signal transduction
   04064 NF-kappa B signaling pathway
    464586 (SYK)
   04072 Phospholipase D signaling pathway
    464586 (SYK)
   04151 PI3K-Akt signaling pathway
    464586 (SYK)
 Organismal Systems
  Immune system
   04611 Platelet activation
    464586 (SYK)
   04650 Natural killer cell mediated cytotoxicity
    464586 (SYK)
   04662 B cell receptor signaling pathway
    464586 (SYK)
   04664 Fc epsilon RI signaling pathway
    464586 (SYK)
   04666 Fc gamma R-mediated phagocytosis
    464586 (SYK)
  Development
   04380 Osteoclast differentiation
    464586 (SYK)
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    464586 (SYK)
  Infectious diseases
   05152 Tuberculosis
    464586 (SYK)
   05169 Epstein-Barr virus infection
    464586 (SYK)
Enzymes [BR:ptr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     464586 (SYK)
Protein kinases [BR:ptr01001]
 Tyrosine protein kinases
  Syk family
   464586 (SYK)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
Position
9
AA seq 635 aa AA seqDB search
MASSGMADSANHLPFFFGNITREEAEDYLVQGGMSDGLYLLRQSRNYLGGFALSVAHGKK
AHHYTIERELNGTYAIAGGRTHASPADLCHYHSQESDGLVCLLKKPFNRPQGVQPKTGPF
EDLKENLIREYVKQTWNLQGQALEQAIISQKPQLEKLIATTAHEKMPWFHGKISREESEQ
IVLIGSKTNGKFLIRARDNNGSYALCLLHEGKVLHYRIDKDKTGKLSIPEGKKFDTLWQL
VEHYSYKADGLLRVLTVPCQKIGTQGNVNFGGRPQLPGSHPATWSAGGIISRIKSYSFPK
PGHRKSSPAQGNRQESTVSFNPYEPELAPWAAEKGPQREALPMDTEVYESPYADPEEIRP
KEVYLDRKLLTLEDKELGSGNFGTVKKGYYQMKKVVKTVAVKILKNEANDPALKDELLAE
ANVMQQLDNPYIVRMIGICEAESWMLVMEMAELGPLNKYLQQNRHVKDKNIIELVHQVSM
GMKYLEESNFVHRDLAARNVLLVTQHYAKISDFGLSKALRADENYYKAQTHGKWPVKWYA
PECINYYKFSSKSDVWSFGVLMWEAFSYGQKPYRGMKGSEVTAMLEKGERMGCPAGCPRE
MYDLMNLCWTYDVENRPGFAAVELRLRNYYYDVVN
NT seq 1908 nt NT seq  +upstreamnt  +downstreamnt
atggccagcagcggcatggctgacagcgccaaccacctgcccttctttttcggcaacatc
acccgggaggaggcagaagattacctggtccaggggggcatgagtgatgggctttatttg
ctgcgccagagccgcaactacctgggcggcttcgccctgtccgtggcccacgggaagaag
gcacaccactacaccatcgagcgggagctgaatggcacctacgccatcgctggtggcagg
acccatgccagccctgccgacctctgccactaccactcccaggagtctgatggcctggtc
tgcctcctcaagaagcccttcaaccggccccaaggggtgcagcccaagactgggcccttt
gaggatttgaaggaaaacctcatcagggaatatgtgaagcagacatggaacctgcagggt
caggctctggagcaggccatcatcagtcagaagcctcagctggagaagctgatcgctacc
acagcccatgaaaaaatgccttggttccatggaaaaatctctcgggaagaatctgagcaa
attgtcctgataggatcaaagacaaatggaaagttcctgatccgagccagagacaacaat
ggctcctacgccctgtgcctgctgcacgaagggaaggtgctgcactatcgcatcgacaaa
gacaagacagggaagctctccatccccgagggaaagaagttcgacacgctctggcagcta
gtcgagcattattcttataaagcagatggtttgttaagagttcttactgtcccatgtcaa
aaaatcggcacacagggaaatgttaattttggaggccgtccacaacttccaggttcccat
cctgcgacttggtcagcgggtggaataatctcaagaatcaaatcatactccttcccaaag
cctggccacagaaagtcctcccctgcccaagggaaccggcaagagagtactgtgtcattc
aatccgtatgagccagaacttgcaccctgggctgcagaaaaaggcccccagagggaagcc
ctacccatggacacagaggtgtacgagagcccctacgcggaccccgaggagatcaggccc
aaggaggtttacctggaccgaaagctgctgacgctggaagacaaagaactgggctctggt
aattttggaactgtgaaaaagggctactaccaaatgaaaaaagttgtgaaaaccgtggct
gtgaaaatactgaaaaacgaggccaatgaccccgctcttaaagatgagttattagcagaa
gcaaatgtcatgcagcagctggacaacccgtacatcgtgcgcatgattgggatatgcgag
gccgagtcctggatgctggttatggagatggcagaacttggtcccctcaataagtatttg
cagcagaacagacatgtcaaggataagaacatcatagaactggttcatcaggtttccatg
ggcatgaagtacttggaggagagcaattttgtgcacagagatctggctgcaagaaatgtg
ttgctagttacccaacattacgccaagatcagtgatttcggactttccaaagcactgcgt
gctgatgaaaactactacaaggcccagacccatggaaagtggcctgtcaagtggtacgct
ccagaatgcatcaactactacaagttctccagcaaaagcgatgtctggagctttggagtg
ttgatgtgggaagcattctcctatgggcagaagccatatcgagggatgaaaggaagtgaa
gtcaccgctatgttagagaaaggagagcggatggggtgccctgcagggtgtccaagagag
atgtacgatctcatgaatctgtgctggacatacgatgtggaaaacaggcccggattcgca
gcagtggaactgcggctgcgcaattactactatgacgtggtgaactaa

DBGET integrated database retrieval system