KEGG   Pan troglodytes (chimpanzee): 464675Help
Entry
464675            CDS       T01005                                 

Gene name
ALAD
Definition
aminolevulinate dehydratase
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ptr00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    464675 (ALAD)
Enzymes [BR:ptr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     464675 (ALAD)
Exosome [BR:ptr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   464675 (ALAD)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
9
AA seq 322 aa AA seqDB search
MPQCPLAHAMQPQSVLHSGYFHPLLRAWQTATTTLNASNLIYPIFVTYGVNRLEEMLRPL
VEEGLRCVLIFGVPSRVPKDERGSAADSEESPAIEAIHLLRKTFPNLLVACDVCLCPYTS
HGHCGLLSENGAFRAEESRQRLAEVALAYAKAGCQVVAPSDMMDGRVEAIKEALMAHGLG
NRVSVMSYSAKFASCFYGPFRDAAKSSPAFGDRRCYQLPPGARGLALRAVDRDVREGADM
LMVKPGMPYLDIVREVKDKHPDLPLAVYHVSGEFAMLWHGAQAGAFDLKAAVLEAMTAFR
RAGADIIITYYTPQLLQWLKEE
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgccccagtgcccactggcccacgccatgcagccccagtccgttctgcacagcggctac
ttccacccactacttcgggcctggcagacagccaccaccaccctcaatgcctccaacctc
atctaccccatctttgtcacgtatggtgtgaaccggctggaagagatgctgaggcccttg
gtggaagagggcctacgctgtgtcttgatctttggcgtccccagcagagttcccaaggac
gagcggggttccgcagctgactctgaggagtccccagctattgaggcaatccatctgttg
aggaagaccttccccaacctcctggtggcctgtgacgtctgcctgtgtccctacacctcc
catggtcactgcgggctcctgagtgaaaatggagcattccgggctgaggagagccgccag
cggctggctgaggtggcattggcgtatgccaaggcaggatgtcaggtggtagccccgtcg
gacatgatggatggacgcgtggaagccatcaaagaggccctgatggcacatggacttggc
aacagggtatcggtgatgagctacagtgccaaatttgcttcctgtttctatggccctttc
cgggatgcggctaagtcaagcccagcttttggggaccgccgctgctaccagctgccccct
ggagcacgaggcctggctctccgagcggtggaccgggatgtacgggaaggagctgacatg
ctcatggtgaagccgggaatgccctacctggacatcgtgcgggaggtaaaggacaagcac
cctgacctccctctcgccgtgtaccacgtctctggagagtttgccatgctgtggcatgga
gcccaggccggggcatttgatctcaaggctgccgtactggaggccatgactgccttccgc
agagcaggtgctgacatcatcatcacctactacacaccacagctgctacagtggctgaag
gaggaatga

DBGET integrated database retrieval system