KEGG   Pan troglodytes (chimpanzee): 464795Help
Entry
464795            CDS       T01005                                 

Gene name
USP20
Definition
ubiquitin specific peptidase 20
Orthology
K11848  
ubiquitin carboxyl-terminal hydrolase 20/33 [EC:3.1.2.15]
Organism
ptr  Pan troglodytes (chimpanzee)
Brite
Enzymes [BR:ptr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     464795 (USP20)
Peptidases [BR:ptr01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   464795 (USP20)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
9
AA seq 914 aa AA seqDB search
MGDSRNLCPHLDSIGEVTKEDLLLKSKGTCQSCGVTGPNLWACLQVACPYVGCGESFADH
STIHAQAKKHNLTVNLTTFRLWCYACEKEVFLEQRLAAPLLGSSSKFSEQDSPPPSHPLK
AVPIAVADEGESESEDDDLKPRGLTGMKNLGNSCYMNAALQALSNCPPLTQFFLECGGLV
RTDKKPALCKSYQKLVSEVWHKKRPSYVVPTSLSHGIKLVNPMFRGYAQQDTQEFLRCLM
DQLHEELKEPVVATVALTEPRDSDSSDTDEKREGDRSPSEDEFLSCDSSSDRGEGDGQGR
GGGSSQAETELLIPDEAGRAISEKERMKDRKFSWGQQRTNSEQVDEDADVDTAMAALDDQ
PAEAQPPSPRSSSPCRTPEPDNDAHLRSSSRPCSPVHHHEGHAKLSSSPPRASPVRMAPS
YVLKKAQVLSAGSRRRKEQRYRSVISDIFDGSILSLVQCLTCDRVSTTVETFQDLSLPIP
GKEDLAKLHSAIYQNVPAKPGACGDSYAAQGWLAFIVEYIRRFVVSCTPSWFWGPVVTLE
DCLAAFFAADELKGDNMYSCERCKKLRNGVKYCKVLRLPEILCIHLKRFRHEVMYSFKIN
SHVSFPLEGLDLRPFLAKECTSQITTYDLLSVICHHGTAGSGHYIAYCQNVINGQWYEFD
DQYVTEVHETVVQNAEGYVLFYRKSSEEAVRERQQVVSLAAMREPSLLRFYVSREWLNKF
NTFAEPGPITNQTFLCSHGGIPPHKYHYIDDLVVILPQNVWEHLYNRFGGGPAVNHLYVC
SICQVEIEALAKRRRIEIDTFIKLNKAFQAEESPGVIYCISMQWFREWEAFVKGKDNEPP
GPIDNSRIAQVKGSGHVQLKQGADYGQISEETWTYLNSLYGGGPEIAIRQSVAQPLGPES
LHGEQKIEAETRAV
NT seq 2745 nt NT seq  +upstreamnt  +downstreamnt
atgggggactccaggaacctttgccctcaccttgactccataggagaggtgaccaaagag
gacttgctgctcaaatctaagggaacctgtcagtcgtgtggggtcaccggaccaaaccta
tgggcctgtctccaggttgcctgcccctatgttggctgcggagaatccttcgctgaccac
agcaccattcatgcacaggcaaaaaagcacaacttgaccgtgaacctgaccacgttccga
ctgtggtgttacgcctgtgagaaggaggtattcctggagcagcggctggcagcccctctg
ctgggctcctcttccaagttctctgaacaggactccccgccaccctcccaccctctgaaa
gctgttcctattgctgtggctgatgaaggagagtctgagtcagaggacgatgacctgaaa
cctcgaggcctcacgggcatgaagaacctcgggaactcctgctacatgaacgccgccctg
caggccctgtccaattgcccgccgctgactcagttcttcttggagtgtggcggcctggtg
cgcacagataagaagccagccctgtgcaagagctaccagaagctggtctctgaggtctgg
cataagaaacggccaagctacgtggtccccaccagtctgtctcatgggatcaagttggtc
aacccaatgttccgaggctatgcccagcaggacacccaagagttccttcgctgcctgatg
gaccagctgcacgaggagctcaaggagccggtggtggccacggtggcgctgacggagcct
cgggactcagattcgagtgacacagatgagaaacgggagggtgaccggagcccatcagaa
gatgagttcttgtcctgtgactcgagcagtgaccggggtgagggtgacgggcaggggcgt
ggcgggggcagctcgcaggccgagacggagctgctgatcccagatgaggcgggccgagcc
atctctgagaaggagcggatgaaggaccgcaagttctcctggggccagcagcgcacaaat
tcagagcaagtggacgaggacgctgatgtggacactgccatggctgcccttgacgaccag
cccgcggaggcccagcccccgtcaccacggtcctccagcccctgccggacgccagagccg
gacaatgatgctcacctacgcagctcctctcgcccctgcagccccgtccaccaccacgag
ggccatgccaagctgtctagcagcccccctcgtgcaagccccgtgaggatggcaccgtcg
tacgtgctcaagaaagcccaggtattgagtgctggcagccggaggcggaaggagcagcgc
taccgcagcgtcatctcagacatctttgacggctccattctcagcctcgtgcagtgtctc
acctgtgaccgggtatccaccacagtggaaacattccaggacttatcactgcccattcct
ggcaaggaggacctggccaagctccattcagccatctaccagaatgtgccggccaagcca
ggcgcctgtggggacagctatgccgcccagggctggctggccttcattgtggagtacatc
cgacggtttgtggtatcctgtacccccagctggttttgggggcctgtcgtcaccctggaa
gactgccttgctgccttctttgccgctgatgagttaaagggtgacaacatgtacagctgt
gagcggtgtaagaagctgcggaacggagtgaagtactgcaaagtcctgcggttgcccgag
atcctgtgcattcacctaaagcgctttcggcacgaggtgatgtactcattcaagatcaac
agccacgtctccttccccctcgaggggctcgacctgcgccccttccttgccaaggagtgc
acatcccagatcaccacctacgacctcctctcggtcatctgccaccacggcacggcaggc
agtgggcactacatcgcctactgccagaacgtgatcaatgggcagtggtacgagtttgat
gaccagtacgtcacagaagtccacgagacagtggtgcagaacgctgagggctacgtactc
ttctacaggaagagcagcgaggaggccgtgcgggagcgacagcaggtggtgtccctggcc
gccatgcgggagcccagcctgctgcggttctacgtgtcccgcgagtggctcaacaagttc
aacaccttcgcggagccaggccccatcaccaaccagaccttcctctgctcccacggaggc
atcccgccccacaaataccactacatcgacgacctggtggtcatcctgccccagaacgtc
tgggagcacctgtacaacagattcgggggtggccccgccgtgaaccacctgtacgtgtgc
tccatctgccaggtggagatcgaggcactggccaagcgcaggaggatcgagatcgacacc
ttcatcaagttgaacaaggccttccaggccgaggagtcgccgggcgtcatctactgcatc
agcatgcagtggttccgggagtgggaggcgttcgtcaaggggaaggacaacgagcccccc
gggcccattgacaacagcaggattgcacaggtcaaaggaagcggccacgtccagctgaag
cagggagctgactacgggcagatttcggaggagacctggacctacctgaacagcctgtat
ggaggtggccccgagattgccatccgccagagcgtggcgcagccgctgggcccagagagc
ctgcacggggagcagaagatcgaagccgagacgcgggctgtgtga

DBGET integrated database retrieval system