KEGG   Pan troglodytes (chimpanzee): 464805Help
Entry
464805            CDS       T01005                                 

Gene name
LAMC3
Definition
(RefSeq) laminin subunit gamma-3 isoform X1
  KO
K06247  laminin, gamma 3
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr04151  PI3K-Akt signaling pathway
ptr04510  Focal adhesion
ptr04512  ECM-receptor interaction
ptr05145  Toxoplasmosis
ptr05146  Amoebiasis
ptr05165  Human papillomavirus infection
ptr05200  Pathways in cancer
ptr05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:ptr00001]
 Environmental Information Processing
  Signal transduction
   04151 PI3K-Akt signaling pathway
    464805 (LAMC3)
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    464805 (LAMC3)
 Cellular Processes
  Cellular community - eukaryotes
   04510 Focal adhesion
    464805 (LAMC3)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    464805 (LAMC3)
   05222 Small cell lung cancer
    464805 (LAMC3)
  Infectious diseases
   05165 Human papillomavirus infection
    464805 (LAMC3)
   05146 Amoebiasis
    464805 (LAMC3)
   05145 Toxoplasmosis
    464805 (LAMC3)
Cell adhesion molecules and their ligands [BR:ptr04516]
 1. Immunoglobulin Superfamily
  Others
   LU; Lutheran blood group glycoprotein [KO:K06578]
    Laminin-14 Extracellular matrix (ECM) components
     464805 (LAMC3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Laminin_EGF Laminin_N Laminin_B
Motif
Other DBs
NCBI-GeneID: 464805
NCBI-ProteinID: XP_016817372
Position
9
AA seq 1581 aa AA seqDB search
MAAAALLLGLALLAPRAAGAGMGACYDGAGRPQRCLPVFENAAFGRLAQASHTCGSPPED
FCPHVGAAGAGAQCQRCDAADPQRHHNASYLTDFHSQDESTWWQSPSMAFGVQYPTSVNI
TLRLGKAYEITYVRLKFHTSRPESFAIYKRSRADGPWEPYQFYSASCQKTYGRPEGQYLR
PGEDERVAFCTSEFSDISPLSGGNVAFSTLEGRPSAYNFEESPGLQEWVTSTELLISLDR
LNTFGDDIFKDPKVLQSYYYAVSDFSVGGRCKCNGHASECGPDVAGQLACRCQHNTTGTD
CERCLPFFQDRPWARGTAEAAHECLPCNCSGRSEECTFDRELFRSTGHGGRCHHCRDHTA
GPHCERCQENFYHWDPRMPCQPCDCHSAGSLHLQCDDTGTCACKPTVTGWKCDRCLPGFH
SLSEGGCRPCTCNPAGSLDTCDPRSGRCPCKENVEGNLCDRCRPGTFNLQPHNPAGCSSC
FCYGHSKVCAATAQFQVHHILTDFHQGAEGWWARSVGGSEHPPQWSPNGVLLSPEDEEEL
TAPEKFLGDQRFSYGQPLILTFRVPPGDSPLPVQLRLEGAGLALSLRHSSLSGPQDAGHP
REVELRFHLQETSEDVAPPLPPFHFQRLLANLTSLRLHVSPGPSPAGPVFLTEVRLTSAR
PGLSPPASWVETCSCPSGYTGQFCESCAPGYKREMPQGGPYASCVPCTCNQHGTCDPNTG
ICVCSHHTEGPSCERCLPGFYGNPFAGQADDCQPCPCPGQSACTTIPESGEVVCTHCPPG
QRGRRCEVCDDGFFGDPLGLFGHPQPCHQCQCSGNVDPNAVGNCDPLSGHCLRCLHNTTG
DHCEHCQEGFYGSALAPRPADKCMPCSCHPQGSVSEQMPCDPVTGQCSCLPHVTARDCSR
CYPGFFDLQPGRGCRSCKCHPLGSQEDQCHPKTGQCTCRPGVTGQACDRCQLGFFGFSIK
GCRACRCSPLGAASAQCHENGTCVCRPGFEGYKCDRCHDNFFLTADGTHCQECPSCYALV
KEEAAKLKARLTLTEGWLQGSNCGSPWGPLDILLGEAPRGDVYQGHHLLPGAREAFLEQM
MGLEGAVKAAREQLQRLNKGARCAQAGSQKTCTQLADLEAVLESSEEEILHAAAILASLG
IPQEGPSQPTKWSHLATEARALARSHRDTATKIAATAWRALLASNTSYALLWNLLEGRVA
LETQRDLEDRYQEVQAAHKALRTAVAEVLPEAESVLATVQQVGADTAPYLALLASPGALP
QKSRAEDLGLKAKALEKTVASWQHMATEAARTLQTAAQATLRQTEPLTKLHQEARGALTQ
ASSSVQAATVTVMGARTLLADLEASAGFAGMKLQFPRPKDQAALQRKADSVSDRLLADTR
KKTKQVERMLGNAAPLSSSAKKKGREAEVLAKDSAKLAKALLRERKQAHRRASRLTSQTQ
ATLQQASQQVLASEARRQELEEAERVGAGLSEMEQQIRESRISLEKDIETLSELLARLGS
LDTHQAPVQALNETQWALERLRLQLGSPGSLQRKLSLLEQESQQQELQIQGFESDLAEIR
ADKQNLEAILHSLPENCASWQ
NT seq 4746 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggctgcgcttctgctggggctggcgctactggcaccgcgggcggccggcgcg
ggcatgggcgcgtgctatgacggcgcagggcgcccgcagcgctgcctgccggtgttcgag
aacgcggcgtttgggcggctcgcccaggcctcgcacacgtgcggcagcccgcccgaggac
ttctgtccccacgtgggcgccgcgggcgcgggggctcagtgccagcgctgcgacgccgcc
gacccccagcgccaccacaacgcctcctacctcaccgacttccacagccaggacgagagc
acctggtggcagagcccgtccatggccttcggcgtgcagtaccccacctcggtcaacatc
accctccgcctagggaaggcttacgagatcacgtatgtgaggctgaagttccacaccagt
cgccctgagagcttcgccatctacaagcgcagccgcgccgacggcccgtgggagccctac
cagttctacagcgcctcctgccagaagacctacggccggcccgagggccagtacctgcgc
cccggcgaggacgagcgcgtggccttctgcacctctgagttcagcgacatctccccgctg
agtggcggcaacgtggccttctccaccctggagggccggcccagcgcctacaactttgag
gagagccctgggctgcaggagtgggtcaccagcaccgaactcctcatctctctagaccgg
ctcaacacgtttggggatgacatcttcaaggaccccaaggtgctccagtcctactattat
gccgtgtccgacttctctgtgggcggcaggtgcaagtgcaacgggcatgccagcgagtgc
ggccccgacgtggcgggccagttggcctgccggtgccagcacaacaccaccggcacagac
tgtgagcgctgcctgcccttcttccaggaccgcccgtgggcccggggcaccgccgaggct
gcccacgagtgtctgccctgcaactgcagtggccgctccgaggaatgcacgtttgatcgg
gagctcttccgcagcacaggccacggcgggcgctgtcaccactgccgtgaccacacagct
gggccacactgtgagcgctgtcaggagaatttctatcactgggacccgcggatgccatgc
cagccctgtgactgccactcggcaggctccctacacctccagtgcgatgacacaggcacc
tgcgcctgcaagcccactgtgactggctggaagtgtgaccgctgtctgcccgggttccac
tcgctcagtgagggaggctgcagaccctgcacttgcaatcccgctggcagcctggacacc
tgtgacccccgcagtgggcgctgcccctgcaaagagaatgtggaaggcaacctatgtgac
agatgtcgcccggggacctttaacctgcagccccacaatccagctggctgcagcagctgt
ttctgctatggccactccaaggtgtgcgcggccactgcccagttccaggtgcatcacatc
ctcaccgatttccaccagggagccgaaggctggtgggccagaagtgtggggggctctgag
caccccccacaatggagcccaaatggggtcctcctgagcccagaagacgaggaggagctc
acagcaccagagaagttcctgggagaccagcggttcagctatgggcagcccctcatactg
accttccgggtgccccccggggactccccactccctgtgcagctgaggctggaaggggca
ggcttggccctgtccctgaggcactctagcctgtctggcccccaggatgccgggcatccc
agggaggtagagctcaggttccacctgcaggagacctccgaggacgtggcccctccactg
ccccccttccacttccagcggctcctcgccaacctgaccagcctccgcctccacgtcagt
cccggccccagccctgctggtccagtgttcctgactgaggtccggctcacatccgcccgg
ccagggctttctccgccagcctcctgggtggagacttgttcatgtcccagtggctacacg
ggccagttctgtgaatcctgtgctccgggatacaagagggagatgccacaggggggtccc
tatgccagctgtgtcccctgcacctgtaaccagcatggcacctgtgaccccaacacaggg
atctgtgtctgcagccaccataccgagggcccatcctgtgaacgctgtttgccaggtttc
tatggcaaccctttcgcgggccaagccgacgactgccagccctgtccctgccctggccag
tcggcctgtacgaccatcccagagagcggggaggtggtgtgcacccactgccccccgggc
cagagagggcggcgctgtgaggtctgtgatgatggcttttttggggacccgctggggctc
tttgggcacccccagccctgccaccagtgccagtgtagcgggaacgtggaccccaatgcc
gtgggcaactgtgaccccctgtctggccactgcctgcgctgcctgcacaacaccacgggt
gaccactgtgagcactgtcaggaaggcttctacgggagcgccctggcccctcgacccgca
gacaaatgcatgccttgcagctgtcacccacagggctcggtcagtgagcagatgccctgc
gacccagtgacaggccaatgctcctgcctgcctcatgtgactgcacgggactgcagccgc
tgctaccctggcttcttcgacctccagcctgggaggggctgccggagctgcaagtgtcac
ccactgggctcccaggaggaccagtgccatcccaagactggacagtgcacctgccgccca
ggtgtcacaggccaggcctgtgacagatgccagctgggtttcttcggcttctccatcaag
ggctgccgggcctgcaggtgctccccactgggcgctgcctcggcccagtgccatgagaac
ggcacatgcgtgtgcaggcctggcttcgagggctacaaatgtgaccgctgccacgacaac
ttcttcctcacggcagacggcacacactgccaggaatgtccgtcctgctacgccctggtg
aaggaggaggcagccaagctgaaggccagactgactttgacggaggggtggctgcaaggg
tccaactgtggcagtccctggggaccactagacattctgctgggagaggccccaaggggg
gacgtctaccagggccatcacctgcttccaggggctcgggaagccttcctggagcagatg
atgggcctcgagggtgctgtgaaggccgcccgggagcagctgcagaggctgaacaagggt
gcccgctgtgcccaggccggatcccagaagacctgcacccagctggcagacctggaggca
gtgctggagtcctcggaagaggagattctgcatgcagctgccattctcgcgtctctgggg
attcctcaggaaggtcccagtcagccgaccaaatggagccacctggccacagaggcccgt
gccctcgccaggagccacagagacaccgccaccaagatcgcagccactgcttggagggcc
ctgctcgcctccaacaccagctacgcgcttctctggaatctgctggagggaagggtggcc
ctagagacccagcgggacctggaggacaggtaccaggaggtccaggcggcccacaaagca
ctgaggacggctgtggcagaggtgctgcctgaagcggaaagcgtgttggccaccgtgcag
caagttggcgcagatacagccccgtacctggccttgctggcttccccgggagctctgcct
cagaagtcccgggctgaagacctgggcctgaaggcaaaggccctggagaagacagttgca
tcatggcagcacatggccactgaggctgcccgaaccctccagactgctgcccaggcgacg
ctacggcaaacagaacccctcacaaagctgcaccaggaggccagaggcgccctgacccag
gcttcctcatctgtccaggctgcgacagtgactgtcatgggagccaggactctgctggct
gacctggaagcctcagccgggtttgcaggaatgaagttgcagtttccccggcccaaggac
caggcggcattgcagaggaaggcagactccgtcagtgacagactccttgcagacacgaga
aagaagaccaagcaggtggagaggatgctgggaaacgcggcccctctttcctccagtgcc
aagaagaagggcagagaagcagaggtgttggccaaggacagtgccaagcttgccaaggcc
ttgctgagggagcggaaacaggcgcaccgccgtgccagccggctcaccagccagacgcaa
gccacgctccaacaggcgtcccagcaggtgctggcgtctgaagcacgcagacaggagctg
gaggaagctgagcgggtgggtgctgggctgagcgagatggagcagcagatccgggaatca
cgtatctcactggagaaggacatcgagaccttgtcagagctgcttgccaggctggggtcg
ctggacacccatcaagccccagtccaggccctgaacgagactcagtgggcactagaacgc
ctgaggctgcagctgggctccccggggtccttgcagaggaaactcagtctgctggagcag
gaatcccagcagcaggagctgcagatccagggctttgagagtgacctcgccgagatccgc
gccgacaaacagaacctggaggccattctgcacagcctgcccgagaactgtgccagctgg
cagtga

DBGET integrated database retrieval system