KEGG   Pan troglodytes (chimpanzee): 464805Help
Entry
464805            CDS       T01005                                 

Definition
laminin subunit gamma-3-like
Orthology
K06247  
laminin, gamma 3
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
PI3K-Akt signaling pathway
Focal adhesion
ECM-receptor interaction
Toxoplasmosis
Amoebiasis
Pathways in cancer
Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:ptr00001]
 Environmental Information Processing
  Signal transduction
   04151 PI3K-Akt signaling pathway
    464805
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    464805
 Cellular Processes
  Cellular commiunity
   04510 Focal adhesion
    464805
 Human Diseases
  Cancers
   05200 Pathways in cancer
    464805
   05222 Small cell lung cancer
    464805
  Infectious diseases
   05146 Amoebiasis
    464805
   05145 Toxoplasmosis
    464805
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
9
AA seq 1577 aa AA seqDB search
MAAAALLLGLALLAPRAAGAGMGACYDGAGRPQRCLPVFENAAFGRLAQASHTCGSPPED
FCPHVGAAGAGAQCQRCDAADPQRHHNASYLTDFHSQDESTWWQSPSMAFGVQYPTSVNI
TLRLGKAYEITYVRLKFHTSRPESFAIYKRSRADGPWEPYQFYSASCQKTYGRPEGQYLR
PGEDERVAFCTSEFSDISPLSGGNVAFSTLEGRPSAYNFEESPGLQEWVTSTELLISLDR
LNTFGDDIFKDPQVLQSYYYAVSDFSXXXRCKCNGHASECGPDVAGQLACRCQHNTTGTD
CERCLPFFQDRPWARGTAEAAHECLPCNCSGRSEECTFDRELFRSTGHGGRCHHCRDHTA
GPHCERCQENFYHWDPRMPCHPCDCTRQXVGSLHLQCDDTGTCACKPTVTGWKCDRCLPG
FHSLSEGGCRPCTCNPAGSLDTCDPRSGRCPCKENVEGNLCDRCRPGTFNLQPHNPAGCS
SCFCYGHSKVCAATAQFQVHHILTDFHQGAEGWWARSVGGSEHPPQWSPNGVLLSPEDEE
ELTAPEKFLGDQRFSYGQPLILTFRVPPGDSPLPVQLRLEGAGLALSLRHSSLSGPQDAG
HPREVELRFHLQETSEDVAPPLPPFHFQRLLANLTSLRLHVSPGPSPAGPVFLTEVRLTS
ARPGLSPPASWVETCSCPSGYTGQFCESCAPGYKREMPQGGPYASCVPCTCNQHGTCDPN
TGICVCSHHTEGPSCERCLPGFYGNPFAGQADDCQPCPCPGQSACTTIPESGEVVCTHCP
PGQRGRRCEVCDDGFFGDPLGLFGHPQPCHQCQCSGNVDPNAVGNCDPLSGHCLRCLHNT
TGDHCEHCQEGFYGSALAPRPADKCMPCSCHPQGSVSEQMPCDPVTGQCSCLPHVTARDC
SRCYPGFFDLQPGRGCRSCKCHPLGSQEDQCHPKTGQCTCRPGVTGQACDRCQLGFFGFS
IKGCRACRCSPLGAASAQCHENGTCVCRPGFEGYKCDRCHDNFFLTADGTHCQECPSCYA
LVKEEAAKLKARLTLTEGWLQGSNCGSPWGPLDILLGEAPRGDVYQGHHLLPGAREAFLE
QMMGLEGAVKAAREQLQRLNKGARCAQAGSQKTCTQLADLEAVLESSEEEILHAAAILAS
LGIPQEGPSQPTKWSHLATEARALARSHRDTATKIAATAWRALLASNTSYALLWNLLEGR
VALETQRDLEDRYQEVQAAHKALRTAVAEVLPEAESVLATVQQVGADTAPYLALLASPGA
LPQKSRAEDLGLKAKALEKTVASWQHMATEAARTLQTAAQATLRQTEPLTKLHQEARGAL
TQASSSVQAATVTVMGARTLLADLEGMKLQFPRPKDQAALQRKADSVSDRLLADTRKKTK
QVERMLGNAAPLSSSAKKKGREAEVLAKDSAKLAKALLRERKQAHRRASRLTSQTQATLQ
QASQQVLASEARRQELEEAERVGAGLSEMEQQIRESRISLEKDIETLSELLARLGSLDTH
QAPVQALNETQWALERLRLQLGSPGSLQRKLSLLEQESQQQELQIQGFESDLAEIRADKQ
NLEAILHSLPENCASWQ
NT seq 4734 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggctgcgcttctgctggggctggcgctactggcaccgcgggcggccggcgcg
ggcatgggcgcgtgctatgacggcgcagggcgcccgcagcgctgcctgccggtgttcgag
aacgcggcgtttgggcggctcgcccaggcctcgcacacgtgcggcagcccgcccgaggac
ttctgtccccacgtgggcgccgcgggcgcgggggctcagtgccagcgctgcgacgccgcc
gacccccagcgccaccacaacgcctcctacctcaccgacttccacagccaggacgagagc
acctggtggcagagcccgtccatggccttcggcgtgcagtaccccacctcggtcaacatc
accctccgcctagggaaggcttacgagatcacgtatgtgaggctgaagttccacaccagt
cgccctgagagcttcgccatctacaagcgcagccgcgccgacggcccgtgggagccctac
cagttctacagcgcctcctgccagaagacctacggccggcccgagggccagtacctgcgc
cccggcgaggacgagcgcgtggccttctgcacctctgagttcagcgacatctccccgctg
agtggcggcaacgtggccttctccaccctggagggccggcccagcgcctacaactttgag
gagagccctgggctgcaggagtgggtcaccagcaccgaactcctcatctctctagaccgg
ctcaacacgtttggggatgacatcttcaaggacccccaggtgctccagtcctactattat
gccgtgtccgacttctctgnnnnnnccaggtgcaagtgcaacgggcatgccagcgagtgc
ggccccgacgtggcgggccagttggcctgccggtgccagcacaacaccaccggcacagac
tgtgagcgctgcctgcccttcttccaggaccgcccgtgggcccggggcaccgccgaggct
gcccacgagtgtctgccctgcaactgcagtggccgctccgaggaatgcacgtttgatcgg
gagctcttccgcagcacaggccacggcgggcgctgtcaccactgccgtgaccacacagct
gggccacactgtgagcgctgtcaggaaaatttctatcactgggacccgcggatgccatgc
catccctgtgactgcactcggcagtgagtgggctccctacacctccagtgcgatgacaca
ggcacctgcgcctgcaagcccactgtgactggctggaagtgtgaccgctgtctgcccggg
ttccactcgctcagtgagggaggctgcagaccctgcacttgcaatcccgctggcagcctg
gacacctgtgacccccgcagtgggcgctgcccctgcaaagagaatgtggaaggcaaccta
tgtgacagatgtcgcccggggacctttaacctgcagccccacaatccagctggctgcagc
agctgtttctgctatggccactccaaggtgtgcgcggccactgcccagttccaggtgcat
cacatcctcaccgatttccaccagggagccgaaggctggtgggccagaagtgtggggggc
tctgagcaccccccacaatggagcccaaatggggtcctcctgagcccagaagacgaggag
gagctcacagcaccagagaagttcctgggagaccagcggttcagctatgggcagcccctc
atactgaccttccgggtgccccccggggactccccactccctgtgcagctgaggctggaa
ggggcaggcttggccctgtccctgaggcactctagcctgtctggcccccaggatgccggg
catcccagggaggtagagctcaggttccacctgcaggagacctccgaggacgtggcccct
ccactgccccccttccacttccagcggctcctcgccaacctgaccagcctccgcctccac
gtcagtcccggccccagccctgccggtccagtgttcctgactgaggtccggctcacatcc
gcccggccagggctttctccgccagcctcctgggtggagacttgttcatgtcccagtggc
tacacgggccagttctgtgaatcctgtgctccgggatacaagagggagatgccacagggg
ggtccctatgccagctgtgtcccctgcacctgtaaccagcatggcacctgtgaccccaac
acagggatctgtgtctgcagccaccataccgagggcccatcctgtgaacgctgtttgcca
ggtttctatggcaaccctttcgcgggccaagccgacgactgccagccctgtccctgccct
ggccagtcggcctgtacgaccatcccagagagcggggaggtggtgtgcacccactgcccc
ccgggccagagagggcggcgctgtgaggtctgtgatgatggcttttttggggacccgctg
gggctctttgggcacccccagccctgccaccagtgccagtgtagcgggaacgtggacccc
aatgccgtgggcaactgtgaccccctgtctggccactgcctgcgctgcctgcacaacacc
acgggtgaccactgtgagcactgtcaggaaggcttctacgggagcgccctggcccctcga
cccgcagacaaatgcatgccttgcagctgtcacccacagggctcggtcagtgagcagatg
ccctgcgacccagtgacaggccaatgctcctgcctgcctcatgtgactgcacgggactgc
agccgctgctaccctggcttcttcgacctccagcctgggaggggctgccggagctgcaag
tgtcacccactgggctcccaggaggaccagtgccatcccaagactggacagtgcacctgc
cgcccaggtgtcacaggccaggcctgtgacagatgccagctgggtttcttcggcttctcc
atcaagggctgccgggcctgcaggtgctccccactgggcgctgcctcggcccagtgccat
gagaacggcacatgcgtgtgcaggcctggcttcgagggctacaaatgtgaccgctgccac
gacaacttcttcctcacggcagacggcacacactgccaggaatgtccgtcctgctacgcc
ctggtgaaggaggaggcagccaagctgaaggccagactgactttgacggaggggtggctg
caagggtccaactgtggcagtccctggggaccactagacattctgctgggagaggcccca
aggggggacgtctaccagggccatcacctgcttccaggggctcgggaagccttcctggag
cagatgatgggcctcgagggtgctgtgaaggccgcccgggagcagctgcagaggctgaac
aagggtgcccgctgtgcccaggccggatcccagaagacctgcacccagctggcagacctg
gaggcagtgctggagtcctcggaagaggagattctgcatgcagctgccattctcgcgtct
ctggggattcctcaggaaggtcccagtcagccgaccaaatggagccacctggccacagag
gcccgtgccctcgccaggagccacagagacaccgccaccaagatcgcagccactgcttgg
agggccctgctcgcctccaacaccagctacgcgcttctctggaatctgctggagggaagg
gtggccctagagacccagcgggacctggaggacaggtaccaggaggtccaggcggcccac
aaagcactgaggacggctgtggcagaggtgctgcctgaagcggaaagcgtgttggccacc
gtgcagcaagttggcgcagatacagccccgtacctggccttgctggcttccccgggagct
ctgcctcagaagtcccgggctgaagacctgggcctgaaggcaaaggccctggagaagaca
gttgcatcatggcagcacatggccactgaggctgcccgaaccctccagactgctgcccag
gcgacgctacggcaaacagaacccctcacaaagctgcaccaggaggccagaggcgccctg
acccaggcttcctcatctgtccaggctgcgacagtgactgtcatgggagccaggactctg
ctggctgacctggaaggaatgaagttgcagtttccccggcccaaggaccaggcggcattg
cagaggaaggcagactccgtcagtgacagactccttgcagacacgagaaagaagaccaag
caggtggagaggatgctgggaaacgcggcccctctttcctccagtgccaagaagaagggc
agagaagcagaggtgttggccaaggacagtgccaagcttgccaaggccttgctgagggag
cggaaacaggcgcaccgccgtgccagccggctcaccagccagacgcaagccacgctccaa
caggcgtcccagcaggtgctggcgtctgaagcacgcagacaggagctggaggaagctgag
cgggtgggtgctgggctgagcgagatggagcagcagatccgggaatcacgtatctcactg
gagaaggacatcgagaccttgtcagagctgcttgccaggctggggtcgctggacacccat
caagccccagtccaggccctgaacgagactcagtgggcactagaacgcctgaggctgcag
ctgggctccccggggtccttgcagaggaaactcagtctgctggagcaggaatcccagcag
caggagctgcagatccagggctttgagagtgacctcgccgagatccgcgccgacaaacag
aacctggaggccattctgcacagcctgcccgagaactgtgccagctggcagtga

DBGET integrated database retrieval system