KEGG   Pan troglodytes (chimpanzee): 464827Help
Entry
464827            CDS       T01005                                 

Gene name
DBH
Definition
(RefSeq) dopamine beta-hydroxylase
  KO
K00503  dopamine beta-monooxygenase [EC:1.14.17.1]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr00350  Tyrosine metabolism
ptr01100  Metabolic pathways
Module
ptr_M00042  Catecholamine biosynthesis, tyrosine => dopamine => noradrenaline => adrenaline
Brite
KEGG Orthology (KO) [BR:ptr00001]
 Metabolism
  Amino acid metabolism
   00350 Tyrosine metabolism
    464827 (DBH)
Enzymes [BR:ptr01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.17  With reduced ascorbate as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.17.1  dopamine beta-monooxygenase
     464827 (DBH)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cu2_monoox_C Cu2_monooxygen DOMON
Motif
Other DBs
NCBI-GeneID: 464827
NCBI-ProteinID: XP_520341
Ensembl: ENSPTRG00000021521
UniProt: H2QY46
Position
9
AA seq 617 aa AA seqDB search
MPALSRWASLPGPSVREAAFMYSTAVAVFLVILVAALQGSAPRESPLPYHIPLDPEGSLE
LSWNVSYTQEAIHFQLLVRRLKAGVLFGMSDRGELENADLVVLWTDGDTAYFADAWSDQK
GQIHLDPQQDYQLLQVQRTPEGLTLLFKRPFGTCDPKDYLIEDGTVHLVYGILEEPFRSL
EAINGSGLQTGLQRVQLLKPNIPEPELPSDACTMEVQAPNIQIPSQETTYWCYIKELPKG
FSRHHIIKYEPIVTKGNEALVHHMEVFQCAPELDSVPHFSGPCDSKMKPDRLNYCRHVLA
AWALGAKAFYYPEEAGLAFGGPGSSRYLRLEVHYHNPLVIEGRNDSSGIRLYYTAKLRRF
NAGIMELGLVYTPVMAIPPRETAFILTGYCTDKCTQLALPPSGIHIFASQLHTHLTGRKV
VTVLVRDGREWEIVNQDNHYSPHFQEIRMLKKVVSVHPGDVLITSCTYNTEDRELATVGG
FGILEEMCVNYVHYYPQTQLELCKSAVDAGFLQKYFHLINRFNNEDVCTCPQASVSQQFT
SVPWNSFNRDVLKALYSFAPISMHCNKSSAVRFQGEWNLQPLPKVISTLEEPTPQCPTSQ
GQSPAGPTVVSIGGGKG
NT seq 1854 nt NT seq  +upstreamnt  +downstreamnt
atgcccgccctcagtcgctgggccagcctgcccggccccagcgtgcgggaggcagccttc
atgtacagcacagcagtggccgtcttcctggtcatcctggtggccgcactgcagggctcg
gctccccgtgagagccccctcccctatcacatccccctggacccagaggggtccctggag
ctctcatggaatgtcagctacacccaggaggccatccatttccagctcctggtgcggagg
ctcaaggctggcgtcctgtttgggatgtccgaccgtggcgagcttgagaacgcagacctc
gtggtgctctggaccgatggggacactgcctattttgcggacgcgtggagtgaccagaag
gggcagatccacctggatccccagcaggactaccagctgctgcaggtgcagaggacccca
gaaggcctgaccctgcttttcaagaggccctttggcacctgcgaccccaaggattacctc
attgaggacggcactgtccacttggtctacgggatcctggaggagccgttccggtcactg
gaggccatcaacggctcgggcctgcagacggggctgcagagggtgcagctcctgaagccc
aatatccccgaaccggagttgccctcggacgcgtgcaccatggaggtccaagctcccaat
atccagatccccagccaggagaccacgtactggtgctacattaaggagcttccaaagggc
ttctctcggcaccacattatcaagtacgagcccatcgtcaccaagggcaatgaggccctc
gtccaccacatggaagtcttccagtgcgcccccgagctggacagcgtcccccacttcagc
gggccctgcgactccaagatgaaacccgaccgcctcaactactgccgccacgtgctggcc
gcctgggccctgggcgccaaggcattttactacccagaggaagccggccttgccttcggg
ggtccagggtcctccagatatctccgcctggaagttcactaccacaacccactggtgata
gaaggacgaaacgactcctcaggcatccgcttgtactacacagccaagctgcggcgcttc
aacgcggggatcatggagctgggactggtgtacacgccagtgatggccattccaccacgg
gagaccgccttcatcctcactggctactgcacggacaagtgcacccagctggcactgcct
ccctccgggatccacatcttcgcctctcagctccacacacacctgactgggagaaaggtg
gtcacagtgctggtccgggacggccgggagtgggagatcgtgaaccaggacaatcactac
agccctcacttccaggagatccgcatgttgaagaaggtcgtgtcggtccatccgggagat
gtgctcatcacctcctgcacgtacaacacggaagaccgggagctggccacagtggggggc
tttgggatcctggaggagatgtgtgtcaactacgtgcactactacccccagacgcagctg
gagctctgcaagagcgctgtggacgccggcttcctgcagaagtacttccacctcatcaac
aggttcaacaacgaggacgtctgcacctgccctcaggcgtccgtgtctcagcagttcacc
tctgttccctggaactccttcaaccgcgatgtactgaaggccctgtacagcttcgcgccc
atctccatgcactgcaacaagtcctcagccgtccgcttccagggtgaatggaacctgcag
cccctgcccaaggtcatctccacactggaagagcccaccccacagtgccccaccagccag
ggccaaagccctgctggccccaccgttgtcagcattggtgggggcaaaggctga

DBGET integrated database retrieval system