KEGG   Pan troglodytes (chimpanzee): 464827Help
Entry
464827            CDS       T01005                                 

Gene name
DBH
Definition
(RefSeq) dopamine beta-hydroxylase (dopamine beta-monooxygenase)
  KO
K00503  
dopamine beta-monooxygenase [EC:1.14.17.1]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
Tyrosine metabolism
Metabolic pathways
Module
Catecholamine biosynthesis, tyrosine => dopamine => noradrenaline => adrenaline
Brite
KEGG Orthology (KO) [BR:ptr00001]
 Metabolism
  Amino acid metabolism
   00350 Tyrosine metabolism
    464827 (DBH)
Enzymes [BR:ptr01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.17  With reduced ascorbate as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.17.1  dopamine beta-monooxygenase
     464827 (DBH)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
9
AA seq 555 aa AA seqDB search
MSGMQQTPAYKAQLLVRRLKAGVLFGMSDRGELENADLVVLWTDGDTAYFADAWSDQKGQ
IHLDPQQDYQLLQVQRTPEGLTLLFKRPFGTCDPKDYLIEDGTVHLVYGILEEPFRSLEA
INGSGLQTGLQRVQLLKPNIPEPELPSDACTMEVQAPNIQIPSQETTYWCYIKELPKGFS
RHHIIKYEPIVTKGNEALVHHMEVFQCAPELDSVPHFSGPCDSKMKPDRLNYCRHVLAAW
ALGAKAFYYPEEAGLAFGGPGSSRYLRLEVHYHNPLVIEGRNDSSGIRLYYTAKLRRFNA
GIMELGLVYTPVMAIPPRETAFILTGYCTDKCTQLALPPSGIHIFASQLHTHLTGRKVVT
VLVRDGREWEIVNQDNHYSPHFQEIRMLKKVVSVHPGDVLITSCTYNTEDRELATVGGFG
ILEEMCVNYVHYYPQTQLELCKSAVDAGFLQKYFHLINRFNNEDVCTCPQASVSQQFTSV
PWNSFNRDVLKALYSFAPISMHCNKSSAVRFQGEWNLQPLPKVISTLEEPTPQCPTSQGQ
SPAGPTVVSIGGGKG
NT seq 1668 nt NT seq  +upstreamnt  +downstreamnt
atgtctgggatgcagcagacacctgcttacaaggcacagctcctggtgcggaggctcaag
gctggcgtcctgtttgggatgtccgaccgtggcgagcttgagaacgcagacctcgtggtg
ctctggaccgatggggacactgcctattttgcggacgcgtggagtgaccagaaggggcag
atccacctggatccccagcaggactaccagctgctgcaggtgcagaggaccccagaaggc
ctgaccctgcttttcaagaggccctttggcacctgcgaccccaaggattacctcattgag
gacggcactgtccacttggtctacgggatcctggaggagccgttccggtcactggaggcc
atcaacggctcgggcctgcagacggggctgcagagggtgcagctcctgaagcccaatatc
cccgaaccggagttgccctcggacgcgtgcaccatggaggtccaagctcccaatatccag
atccccagccaggagaccacgtactggtgctacattaaggagcttccaaagggcttctct
cggcaccacattatcaagtacgagcccatcgtcaccaagggcaatgaggccctcgtccac
cacatggaagtcttccagtgcgcccccgagctggacagcgtcccccacttcagcgggccc
tgcgactccaagatgaaacccgaccgcctcaactactgccgccacgtgctggccgcctgg
gccctgggcgccaaggcattttactacccagaggaagccggccttgccttcgggggtcca
gggtcctccagatatctccgcctggaagttcactaccacaacccactggtgatagaagga
cgaaacgactcctcaggcatccgcttgtactacacagccaagctgcggcgcttcaacgcg
gggatcatggagctgggactggtgtacacgccagtgatggccattccaccacgggagacc
gccttcatcctcactggctactgcacggacaagtgcacccagctggcactgcctccctcc
gggatccacatcttcgcctctcagctccacacacacctgactgggagaaaggtggtcaca
gtgctggtccgggacggccgggagtgggagatcgtgaaccaggacaatcactacagccct
cacttccaggagatccgcatgttgaagaaggtcgtgtcggtccatccgggagatgtgctc
atcacctcctgcacgtacaacacggaagaccgggagctggccacagtggggggctttggg
atcctggaggagatgtgtgtcaactacgtgcactactacccccagacgcagctggagctc
tgcaagagcgctgtggacgccggcttcctgcagaagtacttccacctcatcaacaggttc
aacaacgaggacgtctgcacctgccctcaggcgtccgtgtctcagcagttcacctctgtt
ccctggaactccttcaaccgcgatgtactgaaggccctgtacagcttcgcgcccatctcc
atgcactgcaacaagtcctcagccgtccgcttccagggtgaatggaacctgcagcccctg
cccaaggtcatctccacactggaagagcccaccccacagtgccccaccagccagggccaa
agccctgctggccccaccgttgtcagcattggtgggggcaaaggctga

DBGET integrated database retrieval system