KEGG   Pan troglodytes (chimpanzee): 464883Help
Entry
464883            CDS       T01005                                 

Gene name
ENTPD2
Definition
ectonucleoside triphosphate diphosphohydrolase 2
Orthology
K01509  
adenosinetriphosphatase [EC:3.6.1.3]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
Purine metabolism
Brite
KEGG Orthology (KO) [BR:ptr00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    464883 (ENTPD2)
Enzymes [BR:ptr01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.3  adenosinetriphosphatase
     464883 (ENTPD2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
9
AA seq 443 aa AA seqDB search
MFIYPWTADKKNDTGIVGPHSSCDVPGGGISSYADNPSGASQSLVGCLEQALRDVPKERH
AGTPLYLGATAGMRLLNLTNPEASTSVLTAVTHTLTQYPFDFRGARILSGQEEGVFGWVT
ANYLLENFIKYGWVGRWFRPRKGTLGAMDLGGASTQITFETTSPAEDRASEVQLHLYRPN
YRVYTHSFLCYGRDQVLQRLLASALQTHGFHPCWPRGFSTQVLLGDVYQSPCTMAQRPQT
FNSSARVSLSGSSDPHLCRDLVSGLFSFSSCPFSRCSFNGVFQPPVAGNFVAFSAFFYTV
DFLRTSMGLPVATLQQLEAAAVNVCNQTWAQLQARVPGQRARLADYCAGAMFVQQLLSRG
YGFDERAFGGVIFQKKAADTAVGWALGYMLNLTNLIPADPPGLRKGTDFSSWVVLLLLFA
SALLAALVLLLRQVHSAKLPSTI
NT seq 1332 nt NT seq  +upstreamnt  +downstreamnt
atgtttatctacccttggacggcagacaagaagaacgacacaggcattgtgggccctcac
agctcctgtgatgttccaggtgggggcatctccagctatgcagacaacccttctggggcc
agccagagtcttgttggatgccttgaacaggcgcttcgggatgtgcccaaagagagacac
gcaggcacacccctctacctgggagccacagcgggtatgcgcctgctcaacctgaccaat
ccagaggcctcgaccagtgtgctcacggcagtgactcacacactgacccagtaccccttt
gacttccggggtgcacgcatcctctcgggccaggaagagggggtgtttggctgggtgact
gccaactacctgctggagaacttcatcaagtacggctgggtgggccggtggttccggcca
cggaaggggacactgggggccatggacctggggggtgcctctacccagatcacctttgag
acaaccagtccagctgaggacagagccagcgaggtccagctgcatctctaccgtccgaac
taccgagtctacacccacagcttcctctgctatggccgtgaccaggtcctccagaggctg
ctggccagcgccctccagacccacggcttccacccctgctggccgaggggcttttccacc
caagtgctgctcggggatgtgtaccagtcaccatgcaccatggcccagcggccccagacc
ttcaacagcagtgctagggtcagcctgtcagggagcagtgacccccacctctgccgagat
ctggtttctgggctcttcagcttctcctcctgccccttctcccgatgctctttcaatggg
gtcttccagcccccagtggctgggaactttgtggccttctctgccttcttctacactgtg
gactttttgcggacttcgatggggctgcccgtggccaccctgcagcagctggaggcagcc
gcagtgaatgtctgcaaccagacctgggctcagctgcaagctcgggtgccagggcaacgg
gcccgcctggccgactactgcgccggggccatgttcgtgcagcagctgctgagtcgcggc
tacggcttcgacgagcgcgccttcggcggcgtgatcttccagaagaaggccgcggacact
gcagtgggctgggcgctcggctacatgctgaacctgaccaacctgatccccgccgacccg
ccggggctgcgcaagggcacagacttcagctcctgggtcgtcctcctgctgctcttcgcc
tccgcgctcctggctgcgcttgtcctgctgctgcgtcaggtgcactccgccaagctgcca
agcaccatttag

DBGET integrated database retrieval system