KEGG   Pan troglodytes (chimpanzee): 465082Help
Entry
465082            CDS       T01005                                 

Gene name
TLN1, GBA2
Definition
(RefSeq) talin 1
  KO
K06271  
talin
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
Rap1 signaling pathway
Focal adhesion
Platelet activation
HTLV-I infection
Brite
KEGG Orthology (KO) [BR:ptr00001]
 Environmental Information Processing
  Signal transduction
   04015 Rap1 signaling pathway
    465082 (TLN1)
 Cellular Processes
  Cellular commiunity
   04510 Focal adhesion
    465082 (TLN1)
 Organismal Systems
  Immune system
   04611 Platelet activation
    465082 (TLN1)
 Human Diseases
  Infectious diseases
   05166 HTLV-I infection
    465082 (TLN1)
Exosome [BR:ptr04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   465082 (TLN1)
  Exosomal proteins of other cancer cells
   465082 (TLN1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
9
AA seq 2548 aa AA seqDB search
MVALSLKISIGNVVKTMQFEPSTMVYDACRIIRERIPEAPAGPPSDFGLFLSDDDPKKGI
WLEAGKALDYYMLRNGDTMEYRKKQRPLKIRMLDGTVKTIMVDDSKTVTDMLMTICARIG
ITNHDEYSLVRELMEEKKEEITGTLRKDKTLLRDEKKMEKLKQKLHTDDELNWLDHGRTL
REQGVEEHETLLLRRKFFYSDQNVDSRDPVQLNLLYVQARDDILNGSHPVSFDKACEFAG
FQCQIQFGPHNEQKHKAGFLDLKDFLPKEYVKQKGERKIFQAHKNCGQMSEIEAKVRYVK
LARSLKTYGVSFFLVKEKMKGKNKLVPRLLGITKECVMRVDEKTKEVIQEWNLTNIKRWA
ASPKSFTLDFGDYQDGYYSVQTTEGEQIAQLIAGYIDIILKKKKSKDHFGLEGDEESTML
EDSVSPKKSTVLQQQYNRVGKVEHGSVALPAIMRSGASGPENFQVGSMPPAQQQITSGQM
HRGHMPPLTSAQQALTGTINSSMQAVQAAQATLDDFDTLPPLGQDAASKAWRKNKMDESK
HEIHSQVDAITAGTASVVNLTAGDPAETDYTAVGCAVTTISSNLTEMSRGVKLLAALLED
EGGSGRPLLQAAKGLAGAVSELLRSAQPASAEPRQNLLQAAGNVGQASGELLQQIGESDT
DPHFQDVLMQLAKAVASAAAALVLKAKSVAQRTEDSGLQTQVIAAATQCALSTSQLVACT
KVVAPTISSPVCQEQLVEAGRLVAKAVEGCVSASQAATEDGQLLRGVGAAATAVTQALNE
LLQHVKAHATGAGPAGRYDQATDTILTVTENIFSSMGDAGEMVRQARILAQATSDLVNAI
KADAEGESDLENSRKLLSAAKILADATAKMVEAAKGAAAHPDSEEQQQRLREAAEGLRMA
TNAAAQNAIKKKLVQRLEHAAKQAAASATQTIAAAQHAASTPKASAGPQPLLVQSCKAVA
EQIPLLVQGVRGSQAQPDSPSAQLALIAASQSFLQPGGKMVAAAKASVPTIQDQASAMQL
SQCAKNLGTALAELRTAAQKAQEACGPLEMDSALSVVQNLEKDLQEVKAAARDGKLKPLP
GETMEKCTQDLGNSTKAVSSAIAQLLGEVAQGNENYAGIAARDVAGGLRSLAQAARGVAA
LTSDPAMQAIVLDTASDVLDKASSLIEEAKKAAGHPGDPESQQRLAQVAKAVTQALNRCV
SCLPGQRDVDNALRAVGDASKRLLSDSLPPSTGTFQEAQSRLNEAAAGLNQAATELVQAS
RGTPQDLARASGRFGQDFSTFLEAGVEMAGQAPSQEDRAQVVSNLKGISMSSSKLLLAAK
ALSTDPAAPNLKSQLAAAARAVTDSINQLITMCTQQAPGQKECDNALRELETVRELLENP
VQPINDMSYFGCLDSVMENSKVLGEAMTGISQNAKNGNLPEFGDAISTASKALCGFTEAA
AQAAYLVGVSDPNSQAGQQGLVEPTQFARANQAIQMACQSLGEPGCTQAQVLSAATIVAK
HTSALCNSCRLASARTTNPTAKRQFVQSAKEVANSTANLVKTIKALDGAFTEENRAQCRA
ATAPLLEAVDNLSAFASNPEFSSIPAQISPEGRAAMEPIVISAKTMLESAGGLIQTARAL
AVNPRDPPSWSVLAGHSRTVSDSIKKLITSMRDKAPGQLECETAIAALNSCLRDLDQASL
AAVSQQLAPREGISQEALHTQMLTAVQEISHLIEPLANAARAEASQLGHKVSQMAQYFEP
LTLAAVGAASKTLSHPQQMALLDQTKTLAESALQLLYTAKEAGGNPKQAAHTQEALEEAV
QMMTEAVEDLTTTLNEAASAAGVVGGMVDSITQAINQLDEGPMGEPEGSFVDYQTTMVRT
AKAIAVTVQEMVTKSNTSPEELGPLANQLTSDYGHLASEAKPAAVAAENEEIGSHIKHRV
QELGHGCAALVTKAGALQCSPSDAYTKKELIECARRVSEKVSHVLAALQAGNRGTQACIT
AASAVSGIIADLDTTIMFATAGTLNREGTETFADHREGILKTAKVLVEDTKVLVQNAAGS
QEKLAQAAQSSVATITRLADVVKLGAASLGAEDPETQVVLINAVKDVAKALGDLISATKA
AAGKVGDDPAVWQLKNSAKVMVTNVTSLLKTVKAVEDEATKGTRALEATTEHIRQELAVF
CSPEPPAKTSTPEDFIRMTKGITMATAKAVAAGNSCRQEDVIATANLSRRAIADMLRACK
EAAYHPEVAPDVRLRALHYGRECANGYLELLDHVLLTLQKPSPELKQQCQGLMILTMLPG
AFDLPTLPXPLSSSFIPPGTEWVDPEDPTVIAENELLGAAAAIEAAAKKLEQLKPRAKPK
EADESLNFEEQILEAAKSIAAATSALVKAASAAQRELVAQGKVGAIPANALDDGQWSQGL
ISAARMVAAATNNLCEAANAAVQGHASQEKLISSAKQVAASTAQLLVACKVKADQDSEAM
KRLQAAGNAVKRASDNLVKAAQKAAAFEEQENETVVVKEKMVGGIAQIIAAQEEMLRKER
ELEEARKKLAQIRQQQYKFLPSELRDEH
NT seq 7647 nt NT seq  +upstreamnt  +downstreamnt
atggttgcactttcactgaagatcagcattgggaatgtggtgaagacgatgcagtttgag
ccgtctaccatggtgtacgacgcctgccgcatcattcgtgagcggatcccagaggcccca
gctggtcctcccagcgactttgggctctttctgtcagatgatgaccccaaaaagggtata
tggctggaggctgggaaagctttggactactacatgctccgaaatggggacactatggag
tacaggaagaaacagagacccctgaagatccgtatgctggatggaactgtgaagacgatc
atggtggatgactctaagactgtcactgacatgctcatgaccatctgtgcccgcattggc
atcaccaatcatgatgaatattctttggttcgggagctgatggaagagaaaaaggaggaa
ataacagggaccttaagaaaggacaagacattgctgcgagatgaaaagaagatggagaaa
ctaaagcagaaattgcacacagatgatgagttgaactggctggaccatggtcggacactg
agggagcagggtgtagaggaacacgagacgctgctgctgcggaggaagttcttttactca
gaccagaatgtggattcccgggaccctgtacagctgaacctcctgtatgtgcaggcacga
gatgacatcctgaatggctcccaccctgtctcctttgacaaggcctgtgagtttgctggc
ttccaatgccagatccagtttgggccccacaatgagcagaagcacaaggctggcttcctc
gacctgaaggacttcctgcccaaggagtatgtgaagcagaagggagagcgtaagatcttc
caggcacacaagaattgtgggcagatgagtgagattgaggccaaggtccgctacgtgaag
ctagcccgttctctcaagacttacggtgtctccttcttcctggtgaaggaaaaaatgaaa
gggaagaacaagctagtgcccaggcttctgggcatcaccaaggagtgtgtgatgcgagtg
gatgagaagaccaaggaagtgatccaggagtggaacctcaccaacatcaaacgctgggct
gcgtctcccaaaagcttcaccctggattttggagattaccaagatggctattactcagta
cagacaactgaaggggagcagattgcacagctcattgccggctacatcgatatcatcctg
aagaagaaaaaaagcaaggatcactttgggctggaaggagatgaggagtctactatgctg
gaggactcagtgtcccccaaaaagtcaacagtcctgcagcagcaatacaaccgggtgggg
aaagtggagcatggctctgtggccctgcctgccatcatgcgctctggagcctctggtccc
gagaatttccaggtgggcagcatgccccctgcccagcagcagattaccagcggccagatg
caccgaggacacatgcctcctctgacttcagcccagcaggcactcactggaaccattaac
tccagcatgcaggccgtgcaggctgcccaggccaccctggatgactttgacactctgccg
cctcttggccaggatgctgcctctaaggcctggcgtaaaaacaagatggatgaatcaaag
catgagatccactctcaggtagatgccatcacagctggtactgcatctgtggtgaacctg
acagcaggggaccctgctgagacagactataccgcagtgggctgtgcagtcaccacaatc
tcctccaacctgacggagatgtcccgtggggtgaagctgctggctgccttgctggaggac
gaaggcggcagtggccggcccctgttgcaggcagcaaagggccttgcgggagcagtgtca
gaactgctgcgcagtgcccaaccagccagtgctgagccccgtcagaacctgctgcaagca
gctgggaacgtgggccaggccagtggggagctgttgcaacaaattggggaaagtgatact
gacccccacttccaggatgtgctaatgcagctcgccaaagctgtggcaagtgctgcagct
gccctcgtcctcaaggccaagagtgtggcccagcggacagaggactcgggacttcagacc
caagttattgctgcagcaacacagtgtgccctatccacttcccaactagtggcctgtact
aaggtggtggcacctacaatcagctcacctgtctgccaagagcaactggtggaggctgga
cgactggtagccaaagccgtggagggctgtgtgtctgcctcccaggcagctacagaggat
gggcaactgttgcgaggggtaggagcagcagccacagctgtcacccaggccctaaatgag
ctgctgcagcatgtgaaagcccatgccacaggggctgggcctgctggccgttatgaccag
gctactgacaccatcctaaccgtcactgagaacatctttagctccatgggtgatgctggg
gagatggtgcgacaggcccgcatcctggcccaagccacatctgacctggtcaatgccatc
aaggctgatgctgagggggaaagtgatctcgagaactcccgcaagctcttaagtgctgcc
aagatcctagctgatgccacagccaagatggtagaggctgccaagggagcagccgcccac
cctgacagtgaggagcagcagcagcggctgcgggaggcagctgaggggctgcgcatggcc
accaatgcagccgcgcagaatgccatcaagaaaaagctggtgcagcgcctggagcatgca
gccaagcaggctgcagcctcagccacacagaccatcgctgcagctcaacatgcagcctct
acccccaaggcctctgccggcccccagcccctgctggtgcagagctgcaaggcagtggca
gagcagattccactgctggtgcaaggtgtccgaggaagccaagcccagcctgacagcccc
agcgctcagcttgccctcattgctgccagccagagcttcctgcagccaggtgggaagatg
gtggcagctgcaaaggcctcagtgccaacgattcaggaccaggcttcagccatgcagctg
agtcagtgtgccaagaacctgggcaccgcattggctgaactccggacggctgcccagaag
gctcaggaagcatgtggacctttggagatggattctgcactgagtgtggtacagaatcta
gagaaagatctacaggaagtgaaggcagcagctcgagatggcaagcttaaacccttacct
ggggagacaatggagaagtgtacccaggacctgggcaacagcaccaaagccgtgagctca
gccatcgcccagctactgggagaggttgcccagggcaatgagaattatgcaggtattgca
gctcgggatgtggcaggtgggctgcggtcactggcccaggccgctaggggagtcgctgca
ctgacgtcagatcctgcaatgcaggccattgtacttgatacggccagtgatgtgctggac
aaggccagcagcctcattgaggaggcgaaaaaggcagctggccatccaggggaccctgag
agccagcagcggcttgcccaggtggctaaagcagtgacccaggctctgaaccgctgtgtc
agctgcctacctggccagcgcgatgtggataatgccctgagggcagttggagatgccagc
aagcgactcctgagtgactcgcttcctcctagcactgggacatttcaagaagctcagagc
cggttgaatgaagctgctgctgggctgaatcaggcagccacagaactggtgcaggcctct
cggggaacccctcaggacctggctcgagcctcaggccgatttggacaggacttcagcacc
ttcctggaagctggtgtggagatggcaggccaggctccgagccaggaggaccgagcccaa
gttgtgtccaacttgaagggcatctccatgtcttcaagcaaacttcttctggctgccaag
gccctgtccacggaccctgctgcccctaacctcaagagtcagctggctgcagctgccagg
gcagtaactgacagcatcaatcagctcatcactatgtgcacccagcaggcacccggccag
aaggagtgtgataacgccctgcgggaattggagacggtccgggaactcctggagaaccca
gtccagcccatcaatgacatgtcctactttggttgtctggacagtgtaatggagaactca
aaggtgctgggcgaggccatgactggcatctcccaaaatgccaagaacggaaacctgcca
gagtttggagatgccatttccacagcctcaaaggcactttgtggcttcaccgaggcagct
gcacaggctgcatatctggttggtgtctctgaccccaatagccaagctggacagcaaggg
ctagtggagcccacacagtttgcccgtgcaaaccaggcaattcagatggcctgccagagt
ttgggagagcctggctgtacccaggcccaggtgctctccgcagccaccattgtggctaaa
cacacctctgcgctgtgtaacagctgtcgcctggcttctgcccgtaccaccaatcctact
gccaagcgccagtttgtacagtcagccaaggaggtggccaacagcacagctaatcttgtc
aagaccatcaaggcgctagatggggccttcacagaggagaaccgtgcccagtgccgagca
gcaacagcccctctgctggaggctgtggacaatctgagtgcctttgcgtccaaccctgag
ttctccagcattcctgcccagatcagccctgagggtcgggctgccatggagcccattgtg
atctctgccaagacaatgttagagagtgccgggggactcatccagacagcccgggccctc
gcagtcaatccccgggaccccccgagctggtcggtgctggccggccactcccgtactgtc
tcagactccatcaagaagctaattacaagcatgagggacaaggctccagggcagctggag
tgtgaaacggccattgcagctctgaacagttgtctacgggacctagaccaggcttctctc
gctgcagtcagccagcagcttgctccccgtgagggaatctctcaagaggccttgcacact
cagatgctcactgcagtacaagagatctcccatctcattgagccgctggccaatgctgcc
cgggctgaagcctcccagctgggacacaaggtgtcccagatggcccagtactttgagccg
ctcaccctggctgcagtgggtgctgcctccaagaccctgagccacccgcagcagatggca
ctcctggaccagactaaaacattggcagagtctgccctgcagttgctatacactgccaag
gaggctggtggtaacccaaagcaagcagctcacacccaggaagccctggaggaggctgtg
cagatgatgaccgaggccgtagaggacctgacaacaaccctcaacgaggcagccagtgct
gctggggtcgtgggtggcatggtggactccatcacccaggccatcaaccagctagatgaa
ggaccaatgggtgaaccagaaggttccttcgtggattaccaaacaactatggtgcggaca
gccaaggccattgcagtgaccgttcaggagatggttaccaagtcaaacaccagcccagag
gagctgggccctcttgctaaccagctgaccagtgactatggccatctggcctcggaggcc
aagcctgcagcggtggctgctgaaaatgaagagataggttcccatatcaaacaccgggta
caggagctgggccatggctgtgccgctctggtcaccaaggcaggcgccctgcagtgcagc
cccagtgatgcctacaccaagaaggagctcatagagtgtgcccggagagtctctgagaag
gtctcccacgtcctggctgcgctccaggctgggaatcgtggcacccaggcctgcatcaca
gcagccagcgctgtgtctggtatcattgctgacctcgacaccaccatcatgttcgccact
gctggcacgctcaatcgtgagggtactgaaactttcgctgaccaccgggagggcatcctg
aagactgcgaaggtgctggtggaggacaccaaggtcctggtgcaaaacgcagctgggagc
caggagaagttggcgcaggctgcccagtcctccgtggcgaccatcacccgcctcgctgat
gtggtcaagctgggtgcagccagcctgggagctgaggaccctgagacccaggtggtacta
atcaacgcagtgaaagatgtagccaaagccctgggagacctcatcagtgcaacgaaggct
gcagctggcaaagttggagatgaccctgctgtgtggcagctaaagaactctgccaaggtg
atggtgaccaatgtgacatcattgcttaagacagtaaaagccgtggaagatgaggccacc
aaaggcactcgggccctggaggcaaccacagaacacatacggcaggagctggcggttttc
tgttccccagagccacctgccaagacctctaccccagaagacttcatccgaatgaccaag
ggtatcaccatggcaacagccaaggccgttgctgctggcaattcctgtcgccaggaagat
gtcattgccacagccaatctgagccgccgtgctattgcagatatgcttcgggcttgcaag
gaagcagcttaccacccagaagtggcccctgatgtgcggcttcgagccctgcactatggc
cgggagtgtgccaatggctacctggaactgctggaccatgtactgctgaccctgcagaag
ccaagcccagaactgaagcagcaatgccagggcctgatgatactaaccatgctgcctggt
gcttttgacctccccactctgccttagcctctttcctcttccttcatcccaccaggaaca
gaatgggtagacccagaggaccccacagtcattgctgagaatgagctcctgggagctgca
gccgccattgaggctgcagccaaaaagctagagcagctgaagccccgggccaaacctaag
gaggcagatgagtccttgaactttgaggagcagatactagaagctgccaagtccattgca
gcagccaccagtgcactggtaaaggctgcgtcggctgcccagagagaactagtggcccaa
gggaaggtgggtgccattccagccaatgcactggatgatgggcagtggtcccagggcctc
atttctgctgcccggatggtggctgcggccaccaacaatctgtgtgaggcagccaatgca
gctgtacaaggccatgccagccaggagaagctcatctcatcagccaagcaggtagctgcc
tccacagcccagctccttgtggcctgcaaggtcaaggctgaccaggactcagaggcaatg
aaacgacttcaggctgctggcaacgcagtgaagcgagcctcagataatctggtgaaagca
gcacagaaggctgcagccttcgaagagcaggagaatgagacagtggtggtgaaagagaag
atggttggcggcattgcccagatcatcgcagcacaggaagaaatgcttcggaaggaacga
gagctggaagaggcgcggaagaaactggcccagatccggcagcagcagtacaagtttctg
ccttcagagcttcgagatgagcactaa

DBGET integrated database retrieval system