KEGG   Pan troglodytes (chimpanzee): 465082Help
Entry
465082            CDS       T01005                                 

Gene name
GBA2, TLN1
Definition
glucosidase, beta (bile acid) 2
Orthology
K17108  
non-lysosomal glucosylceramidase [EC:3.2.1.45]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:ptr00600]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:ptr00511]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
9
AA seq 933 aa AA seqDB search
MGTQDPGNMGTGVPASEQISCAKEDPQVYCPEETGGTKDVQVTDCKSPEDSRPQKETDCC
NPEDSGQLMVSYEGKAMGYQVPPFGWRICLAHEFTEKRKPFQANNVSLSNMIKHIGMGLR
YLQWWYRKTQVEKKTPFIDMINSVPLRQIYGCPLGGIGGGTITRGWRGQFCRWQLNPGMY
QHRTVIADQPICSLKFTVCLRREGQTVYQQVLSLERPSVLRSWNWGLCGYFAFYHALYPR
AWTVYQLPGQNVTLTCRQITPILPHDYQDSSLPVGVFVWDVENEGDEALDVSIMFSMRNG
LGGGDDAPGGLWNEPFCLERSGETVRGLLLHHPTLPNPYTMAVAARVTAATTVTHITAFD
PDSTGQQVWQDLLQDGQLDSPTGQSTPTHKGVGIAGAVCVSSKLRPRGQCRLEFSLAWDM
PRIMFGAKGQVHYRRYTRFFGQDGDAAPALSHYALCRYTEWEERISAWQSPVLDDRSLPA
WYKSALFNELYFLADGGTVWLEVLEDSLPEELGRNMCHLRPTLRDYGRFGYLEGQEYRMY
NTYDVHFYASFALIMLWPKLELSLQYDMALATLREDLTRRRYLMSGVMAPVKRRNVIPHD
IGDPDDEPWLRVNAYLIHDTADWKDLNLKFVLQVYRDYYLTGDQNFLKDMWPVCLAVMES
EMKFDKDHDGLIENGGYADQTYDGWVTTGPSAYCGGLWLAAVAVMVQMAALCGAQDIQDK
FSSILSRGQEAYERLLWNGRYYNYDSSSRPQSRSVMSDQCAGQWFLKACGLGEGDTEVFP
TQHVVRALQTIFELNVQAFAGGAMGAVNGMQPHGVPDKSSVQSDEVWVGVVYGLAATMIQ
EGLTWEGFQTAEGCYRTVWERLGLAFQTPEAYCQQRVFRSLAYMRPLSIWAMQLALQQQQ
HKKASWPKVEQGTGLRTGPMFGPKEAMANLSPE
NT seq 2802 nt NT seq  +upstreamnt  +downstreamnt
atggggacccaggatccagggaacatgggaaccggcgtcccagcctcggagcagataagc
tgtgccaaagaggatccacaagtttattgccctgaagagactggcggcaccaaggatgtg
caggttacagactgtaagagtcccgaagacagccgaccccaaaaagagacggactgctgc
aatccggaggactctgggcagctgatggtttcctatgagggtaaagctatgggctaccag
gtgcctccctttggctggcgcatctgtctggctcatgagtttacagagaagaggaaaccc
tttcaagctaacaacgtctccctaagcaacatgataaagcatataggcatgggcttgagg
tacctgcagtggtggtaccggaaaacccaggtggaaaagaagacacctttcatcgacatg
atcaattctgtacccctaagacagatttatggttgtcccttgggtggcatcgggggaggc
actattacccgtggctggagaggccagttctgtcgttggcagcttaaccctggaatgtat
cagcaccggacagtcatcgctgaccaacctatctgctctcttaagttcacagtgtgcctg
cgtcgggaagggcagactgtgtaccagcaagtcctgtccctggagcgcccaagtgtcctc
cgcagctggaactggggcctgtgtgggtactttgctttctaccatgccctctatccccga
gcctggactgtctatcagcttcctggccagaatgtcaccctcacctgccgtcagatcaca
cccatcttgccccatgactaccaggacagcagcctgcctgtaggagtctttgtgtgggat
gtggaaaatgaaggggacgaagctctagatgtgtccatcatgttctccatgcggaatgga
ctgggtggtggagacgatgccccagggggtttgtggaatgagcccttctgtctggagcgt
agcggggaaactgtccgggggctgctcctgcatcatccaacccttccaaacccctacacg
atggctgtggctgcacgagtcacggcagctaccacggtaacccacatcacagcctttgac
cctgacagcacggggcagcaggtgtggcaggatctacttcaggatggacagctggactct
cccactggccaaagcacccctacgcataaaggagtaggcattgctggagctgtgtgtgtt
tccagcaagttgcgacctcgaggccagtgccgcctggagttttcactggcttgggacatg
cccaggatcatgtttggagctaaaggccaagtccactacaggcggtatacaaggttcttt
ggccaggatggagatgcagcacctgccctcagccactatgcactgtgccgatacacagag
tgggaagagaggatctcagcttggcagagcccggtattggatgacagatcactgcctgcc
tggtacaaatctgcgctgttcaatgaactatacttcctggctgatggaggcacagtgtgg
ctggaagttcttgaggactccctaccagaggagctgggcagaaacatgtgtcacctccgc
cccaccctacgggactacggtcgatttggctaccttgagggccaggagtaccgcatgtac
aacacatatgatgtccacttttatgcttcctttgccctcatcatgctctggcccaaactt
gagctcagcctacagtatgacatggctctggccactctcagggaggacctgacacggcga
cggtacctgatgagtggggtgatggcacctgtgaaaaggaggaatgtcatcccccatgat
attggggacccagatgatgaaccatggctccgcgtcaatgcatatttaatccacgatact
gctgattggaaggacctgaacctgaagtttgtgctgcaggtttatcgggactattacctc
acgggtgatcaaaacttcctgaaggacatgtggcctgtgtgtctagctgtgatggaatct
gaaatgaagtttgacaaggaccatgatggactcattgaaaatggaggctatgcagaccag
acctatgatggatgggtgaccacaggccccagtgcttactgtggagggctgtggctggca
gctgtggctgtgatggtccagatggctgctctgtgtggggcacaggacatccaggataag
ttttcttccatcctcagccggggccaagaagcctatgagagactgctgtggaatggccgc
tattacaactatgacagcagctctcggcctcagtctcgtagtgttatgtctgaccagtgt
gctggacagtggttcctgaaggcctgtggcctaggagaaggagacactgaggtgtttcct
acccaacatgtggtccgtgctctccaaactatctttgagctgaacgtccaggcctttgca
ggaggggccatgggggctgtgaatgggatgcagccccatggtgtccctgataaatccagt
gtgcagtctgatgaagtctgggtgggtgtggtctacgggctggcagctaccatgatccaa
gagggcctgacttgggagggcttccagacagctgaaggctgctaccgtaccgtgtgggag
cgcctgggtctggccttccagaccccagaggcatactgccagcagcgagtgttccgctca
ctggcctacatgcggccactgagcatatgggccatgcagctagccctgcaacagcagcag
cacaaaaaggcctcctggccaaaagtcgaacagggcacaggactaaggacagggcctatg
tttggaccaaaggaagccatggcaaacctgagcccagagtga

DBGET integrated database retrieval system