KEGG   Pan troglodytes (chimpanzee): 465082Help
Entry
465082            CDS       T01005                                 

Gene name
TLN1
Definition
(RefSeq) talin 1
  KO
K06271  
talin
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
Rap1 signaling pathway
Focal adhesion
Platelet activation
HTLV-I infection
Brite
KEGG Orthology (KO) [BR:ptr00001]
 Environmental Information Processing
  Signal transduction
   04015 Rap1 signaling pathway
    465082 (TLN1)
 Cellular Processes
  Cellular community - eukaryotes
   04510 Focal adhesion
    465082 (TLN1)
 Organismal Systems
  Immune system
   04611 Platelet activation
    465082 (TLN1)
 Human Diseases
  Infectious diseases
   05166 HTLV-I infection
    465082 (TLN1)
Exosome [BR:ptr04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   465082 (TLN1)
  Exosomal proteins of other cancer cells
   465082 (TLN1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
Position
9
AA seq 2542 aa AA seqDB search
MVALSLKISIGNVVKTMQFEPSTMVYDACRIIRERIPEAPAGPPSDFGLFLSDDDPKKGI
WLEAGKALDYYMLRNGDTMEYRKKQRPLKIRMLDGTVKTIMVDDSKTVTDMLMTICARIG
ITNHDEYSLVRELMEEKKEEITGTLRKDKTLLRDEKKMEKLKQKLHTDDELNWLDHGRTL
REQGVEEHETLLLRRKFFYSDQNVDSRDPVQLNLLYVQARDDILNGSHPVSFDKACEFAG
FQCQIQFGPHNEQKHKAGFLDLKDFLPKEYVKQKGERKIFQAHKNCGQMSEIEAKVRYVK
LARSLKTYGVSFFLVKEKMKGKNKLVPRLLGITKECVMRVDEKTKEVIQEWNLTNIKRWA
ASPKSFTLDFGDYQDGYYSVQTTEGEQIAQLIAGYIDIILKKKKSKDHFGLEGDEESTML
EDSVSPKKSTVLQQQYNRVGKVEHGSVALPAIMRSGASGPENFQVGSMPPAQQQITSGQM
HRGHMPPLTSAQQALTGTINSSMQAVQAAQATLDDFDTLPPLGQDAASKAWRKNKMDESK
HEIHSQVDAITAGTASVVNLTAGDPAETDYTAVGCAVTTISSNLTEMSRGVKLLAALLED
EGGSGRPLLQAAKGLAGAVSELLRSAQPASAEPRQNLLQAAGNVGQASGELLQQIGESDT
DPHFQDVLMQLAKAVASAAAALVLKAKSVAQRTEDSGLQTQVIAAATQCALSTSQLVACT
KVVAPTISSPVCQEQLVEAGRLVAKAVEGCVSASQAATEDGQLLRGVGAAATAVTQALNE
LLQHVKAHATGAGPAGRYDQATDTILTVTENIFSSMGDAGEMVRQARILAQATSDLVNAI
KADAEGESDLENSRKLLSAAKILADATAKMVEAAKGAAAHPDSEEQQQRLREAAEGLRMA
TNAAAQNAIKKKLVQRLEHAAKQAAASATQTIAAAQHAASTPKASAGPQPLLVQSCKAVA
EQIPLLVQGVRGSQAQPDSPSAQLALIAASQSFLQPGGKMVAAAKASVPTIQDQASAMQL
SQCAKNLGTALAELRTAAQKAQEACGPLEMDSALSVVQNLEKDLQEVKAAARDGKLKPLP
GETMEKCTQDLGNSTKAVSSAIAQLLGEVAQGNENYAGIAARDVAGGLRSLAQAARGVAA
LTSDPAMQAIVLDTASDVLDKASSLIEEAKKAAGHPGDPESQQRLAQVAKAVTQALNRCV
SCLPGQRDVDNALRAVGDASKRLLSDSLPPSTGTFQEAQSRLNEAAAGLNQAATELVQAS
RGTPQDLARASGRFGQDFSTFLEAGVEMAGQAPSQEDRAQVVSNLKGISMSSSKLLLAAK
ALSTDPAAPNLKSQLAAAARAVTDSINQLITMCTQQAPGQKECDNALRELETVRELLENP
VQPINDMSYFGCLDSVMENSKVLGEAMTGISQNAKNGNLPEFGDAISTASKALCGFTEAA
AQAAYLVGVSDPNSQAGQQGLVEPTQFARANQAIQMACQSLGEPGCTQAQVLSAATIVAK
HTSALCNSCRLASARTTNPTAKRQFVQSAKEVANSTANLVKTIKALDGAFTEENRAQCRA
ATAPLLEAVDNLSAFASNPEFSSIPAQISPEGRAAMEPIVISAKTMLESAGGLIQTARAL
AVNPRDPPSWSVLAGHSRTVSDSIKKLITSMRDKAPGQLECETAIAALNSCLRDLDQASL
AAVSQQLAPREGISQEALHTQMLTAVQEISHLIEPLANAARAEASQLGHKVSQMAQYFEP
LTLAAVGAASKTLSHPQQMALLDQTKTLAESALQLLYTAKEAGGNPKQAAHTQEALEEAV
QMMTEAVEDLTTTLNEAASAAGVVGGMVDSITQAINQLDEGPMGEPEGSFVDYQTTMVRT
AKAIAVTVQEMVTKSNTSPEELGPLANQLTSDYGRLASEAKPAAVAAENEEIGSHIKHRV
QELGHGCAALVTKAGALQCSPSDAYTKKELIECARRVSEKVSHVLAALQAGNRGTQACIT
AASAVSGIIADLDTTIMFATAGTLNREGTETFADHREGILKTAKVLVEDTKVLVQNAAGS
QEKLAQAAQSSVATITRLADVVKLGAASLGAEDPETQVVLINAVKDVAKALGDLISATKA
AAGKVGDDPAVWQLKNSAKVMVTNVTSLLKTVKAVEDEATKGTRALEATTEHIRQELAVF
CSPEPPAKTSTPEDFIRMTKGITMATAKAVAAGNSCRQEDVIATANLSRRAIADMLRACK
EAAYHPEVAPDVRLRALHYGRECANGYLELLDHVLLPTLQKPSPELKQQLTGHSKRVAGS
VTELIQAAEAMKGTEWVDPEDPTVIAENELLGAAAAIEAAAKKLEQLKPRAKPKEADESL
NFEEQILEAAKSIAAATSALVKAASAAQRELVAQGKVGAIPANALDDGQWSQGLISAARM
VAAATNNLCEAANAAVQGHASQEKLISSAKQVAASTAQLLVACKVKADQDSEAMKRLQAA
GNAVKRASDNLVKAAQKAAAFEEQENETVVVKEKMVGGIAQIIAAQEEMLRKERELEEAR
KKLAQIRQQQYKFLPSELRDEH
NT seq 7629 nt NT seq  +upstreamnt  +downstreamnt
atggttgcactttcactgaagatcagcattgggaatgtggtgaagacgatgcagtttgag
ccgtctaccatggtgtacgacgcctgccgcatcattcgtgagcggatcccagaggcccca
gctggtcctcccagcgactttgggctctttctgtcagatgatgaccccaaaaagggtata
tggctggaggctgggaaagctttggactactacatgctccgaaatggggacactatggag
tacaggaagaaacagagacccctgaagatccgtatgctggatggaactgtgaagacgatc
atggtggatgactctaagactgtcactgacatgctcatgaccatctgtgcccgcattggc
atcaccaatcatgatgaatattctttggttcgggagctgatggaagagaaaaaggaggaa
ataacagggaccttaagaaaggacaagacattgctgcgagatgaaaagaagatggagaaa
ctaaagcagaaattgcacacagatgatgagttgaactggctggaccatggtcggacactg
agggagcagggtgtagaggaacacgagacgctgctgctgcggaggaagttcttttactca
gaccagaatgtggattcccgggaccctgtacagctgaacctcctgtatgtgcaggcacga
gatgacatcctgaatggctcccaccctgtctcctttgacaaggcctgtgagtttgctggc
ttccaatgccagatccagtttgggccccacaatgagcagaagcacaaggctggcttcctc
gacctgaaggacttcctgcccaaggagtatgtgaagcagaagggagagcgtaagatcttc
caggcacacaagaattgtgggcagatgagtgagattgaggccaaggtccgctacgtgaag
ctagcccgttctctcaagacttacggtgtctccttcttcctggtgaaggaaaaaatgaaa
gggaagaacaagctagtgcccaggcttctgggcatcaccaaggagtgtgtgatgcgagtg
gatgagaagaccaaggaagtgatccaggagtggaacctcaccaacatcaaacgctgggct
gcgtctcccaaaagcttcaccctggattttggagattaccaagatggctattactcagta
cagacaactgaaggggagcagattgcacagctcattgccggctacatcgatatcatcctg
aagaagaaaaaaagcaaggatcactttgggctggaaggagatgaggagtctactatgctg
gaggactcagtgtcccccaaaaagtcaacagtcctgcagcagcaatacaaccgggtgggg
aaagtggagcatggctctgtggccctgcctgccatcatgcgctctggagcctctggtccc
gagaatttccaggtgggcagcatgccccctgcccagcagcagattaccagcggccagatg
caccgaggacacatgcctcctctgacttcagcccagcaggcactcactggaaccattaac
tccagcatgcaggccgtgcaggctgcccaggccaccctggatgactttgacactctgccg
cctcttggccaggatgctgcctctaaggcctggcgtaaaaacaagatggatgaatcaaag
catgagatccactctcaggtagatgccatcacagctggtactgcatctgtggtgaacctg
acagcaggggaccctgctgagacagactataccgcagtgggctgtgcagtcaccacaatc
tcctccaacctgacggagatgtcccgtggggtgaagctgctggctgccttgctggaggac
gaaggcggcagtggccggcccctgttgcaggcagcaaagggccttgcgggagcagtgtca
gaactgctgcgcagtgcccaaccagccagtgctgagccccgtcagaacctgctgcaagca
gctgggaacgtgggccaggccagtggggagctgttgcaacaaattggggaaagtgatact
gacccccacttccaggatgtgctaatgcagctcgccaaagctgtggcaagtgctgcagct
gccctcgtcctcaaggccaagagtgtggcccagcggacagaggactcgggacttcagacc
caagttattgctgcagcaacacagtgtgccctatccacttcccaactagtggcctgtact
aaggtggtggcacctacaatcagctcacctgtctgccaagagcaactggtggaggctgga
cgactggtagccaaagccgtggagggctgtgtgtctgcctcccaggcagctacagaggat
gggcaactgttgcgaggggtaggagcagcagccacagctgtcacccaggccctaaatgag
ctgctgcagcatgtgaaagcccatgccacaggggctgggcctgctggccgttatgaccag
gctactgacaccatcctaaccgtcactgagaacatctttagctccatgggtgatgctggg
gagatggtgcgacaggcccgcatcctggcccaagccacatctgacctggtcaatgccatc
aaggctgatgctgagggggaaagtgatctcgagaactcccgcaagctcttaagtgctgcc
aagatcctagctgatgccacagccaagatggtagaggctgccaagggagcagccgcccac
cctgacagtgaggagcagcagcagcggctgcgggaggcagctgaggggctgcgcatggcc
accaatgcagccgcgcagaatgccatcaagaaaaagctggtgcagcgcctggagcatgca
gccaagcaggctgcagcctcagccacacagaccatcgctgcagctcaacatgcagcctct
acccccaaggcctctgccggcccccagcccctgctggtgcagagctgcaaggcagtggca
gagcagattccactgctggtgcaaggtgtccgaggaagccaagcccagcctgacagcccc
agcgctcagcttgccctcattgctgccagccagagcttcctgcagccaggtgggaagatg
gtggcagctgcaaaggcctcagtgccaacgattcaggaccaggcttcagccatgcagctg
agtcagtgtgccaagaacctgggcaccgcattggctgaactccggacggctgcccagaag
gctcaggaagcatgtggacctttggagatggattctgcactgagtgtggtacagaatcta
gagaaagatctacaggaagtgaaggcagcagctcgagatggcaagcttaaacccttacct
ggggagacaatggagaagtgtacccaggacctgggcaacagcaccaaagccgtgagctca
gccatcgcccagctactgggagaggttgcccagggcaatgagaattatgcaggtattgca
gctcgggatgtggcaggtgggctgcggtcactggcccaggccgctaggggagtcgctgca
ctgacgtcagatcctgcaatgcaggccattgtacttgatacggccagtgatgtgctggac
aaggccagcagcctcattgaggaggcgaaaaaggcagctggccatccaggggaccctgag
agccagcagcggcttgcccaggtggctaaagcagtgacccaggctctgaaccgctgtgtc
agctgcctacctggccagcgcgatgtggataatgccctgagggcagttggagatgccagc
aagcgactcctgagtgactcgcttcctcctagcactgggacatttcaagaagctcagagc
cggttgaatgaagctgctgctgggctgaatcaggcagccacagaactggtgcaggcctct
cggggaacccctcaggacctggctcgagcctcaggccgatttggacaggacttcagcacc
ttcctggaagctggtgtggagatggcaggccaggctccgagccaggaggaccgagcccaa
gttgtgtccaacttgaagggcatctccatgtcttcaagcaaacttcttctggctgccaag
gccctgtccacggaccctgctgcccctaacctcaagagtcagctggctgcagctgccagg
gcagtaactgacagcatcaatcagctcatcactatgtgcacccagcaggcacccggccag
aaggagtgtgataacgccctgcgggaattggagacggtccgggaactcctggagaaccca
gtccagcccatcaatgacatgtcctactttggttgtctggacagtgtaatggagaactca
aaggtgctgggcgaggccatgactggcatctcccaaaatgccaagaacggaaacctgcca
gagtttggagatgccatttccacagcctcaaaggcactttgtggcttcaccgaggcagct
gcacaggctgcatatctggttggtgtctctgaccccaatagccaagctggacagcaaggg
ctagtggagcccacacagtttgcccgtgcaaaccaggcaattcagatggcctgccagagt
ttgggagagcctggctgtacccaggcccaggtgctctccgcagccaccattgtggctaaa
cacacctctgcgctgtgtaacagctgtcgcctggcttctgcccgtaccaccaatcctact
gccaagcgccagtttgtacagtcagccaaggaggtggccaacagcacagctaatcttgtc
aagaccatcaaggcgctagatggggccttcacagaggagaaccgtgcccagtgccgagca
gcaacagcccctctgctggaggctgtggacaatctgagtgcctttgcgtccaaccctgag
ttctccagcattcctgcccagatcagccctgagggtcgggctgccatggagcccattgtg
atctctgccaagacaatgttagagagtgccgggggactcatccagacagcccgggccctc
gcagtcaatccccgggaccccccgagctggtcggtgctggccggccactcccgtactgtc
tcagactccatcaagaagctaattacaagcatgagggacaaggctccagggcagctggag
tgtgaaacggccattgcagctctgaacagttgtctacgggacctagaccaggcttctctc
gctgcagtcagccagcagcttgctccccgtgagggaatctctcaagaggccttgcacact
cagatgctcactgcagtacaagagatctcccatctcattgagccgctggccaatgctgcc
cgggctgaagcctcccagctgggacacaaggtgtcccagatggcccagtactttgagccg
ctcaccctggctgcagtgggtgctgcctccaagaccctgagccacccgcagcagatggca
ctcctggaccagactaaaacattggcagagtctgccctgcagttgctatacactgccaag
gaggctggtggtaacccaaagcaagcagctcacacccaggaagccctggaggaggctgtg
cagatgatgaccgaggccgtagaggacctgacaacaaccctcaacgaggcagccagtgct
gctggggtcgtgggtggcatggtggactccatcacccaggccatcaaccagctagatgaa
ggaccaatgggtgaaccagaaggttccttcgtggattaccaaacaactatggtgcggaca
gccaaggccattgcagtgaccgttcaggagatggttaccaagtcaaacaccagcccagag
gagctgggccctcttgctaaccagctgaccagtgactatggccgtctggcctcggaggcc
aagcctgcagcggtggctgctgaaaatgaagagataggttcccatatcaaacaccgggta
caggagctgggccatggctgtgccgctctggtcaccaaggcaggcgccctgcagtgcagc
cccagtgatgcctacaccaagaaggagctcatagagtgtgcccggagagtctctgagaag
gtctcccacgtcctggctgcgctccaggctgggaatcgtggcacccaggcctgcatcaca
gcagccagcgctgtgtctggtatcattgctgacctcgacaccaccatcatgttcgccact
gctggcacgctcaatcgtgagggtactgaaactttcgctgaccaccgggagggcatcctg
aagactgcgaaggtgctggtggaggacaccaaggtcctggtgcaaaacgcagctgggagc
caggagaagttggcgcaggctgcccagtcctccgtggcgaccatcacccgcctcgctgat
gtggtcaagctgggtgcagccagcctgggagctgaggaccctgagacccaggtggtacta
atcaacgcagtgaaagatgtagccaaagccctgggagacctcatcagtgcaacgaaggct
gcagctggcaaagttggagatgaccctgctgtgtggcagctaaagaactctgccaaggtg
atggtgaccaatgtgacatcattgcttaagacagtaaaagccgtggaagatgaggccacc
aaaggcactcgggccctggaggcaaccacagaacacatacggcaggagctggcggttttc
tgttccccagagccacctgccaagacctctaccccagaagacttcatccgaatgaccaag
ggtatcaccatggcaacagccaaggccgttgctgctggcaattcctgtcgccaggaagat
gtcattgccacagccaatctgagccgccgtgctattgcagatatgcttcgggcttgcaag
gaagcagcttaccacccagaagtggcccctgatgtgcggcttcgagccctgcactatggc
cgggagtgtgccaatggctacctggaactgctggaccatgtactgctgccgaccctgcag
aagccaagcccagaactgaagcagcagttgacaggacattcaaagcgtgtggctggttcc
gtcactgagctcatccaggctgctgaagccatgaagggaacagaatgggtagacccagag
gaccccacagtcattgctgagaatgagctcctgggagctgcagccgccattgaggctgca
gccaaaaagctagagcagctgaagccccgggccaaacctaaggaggcagatgagtccttg
aactttgaggagcagatactagaagctgccaagtccattgcagcagccaccagtgcactg
gtaaaggctgcgtcggctgcccagagagaactagtggcccaagggaaggtgggtgccatt
ccagccaatgcactggacgatgggcagtggtcccagggcctcatttctgctgcccggatg
gtggctgcggccaccaacaatctgtgtgaggcagccaatgcagctgtacaaggccatgcc
agccaggagaagctcatctcatcagccaagcaggtagctgcctccacagcccagctcctt
gtggcctgcaaggtcaaggctgaccaggactcagaggcaatgaaacgacttcaggctgct
ggcaacgcagtgaagcgagcctcagataatctggtgaaagcagcacagaaggctgcagcc
ttcgaagagcaggagaatgagacagtggtggtgaaagagaagatggttggcggcattgcc
cagatcatcgcagcacaggaagaaatgcttcggaaggaacgagagctggaagaggcgcgg
aagaaactggcccagatccggcagcagcagtacaagtttctgccttcagagcttcgagat
gagcactaa

DBGET integrated database retrieval system