KEGG   Pan troglodytes (chimpanzee): 465082Help
Entry
465082            CDS       T01005                                 

Gene name
TLN1, GBA2
Definition
talin 1
Orthology
K17108  
non-lysosomal glucosylceramidase [EC:3.2.1.45]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ptr00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    465082 (TLN1)
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    465082 (TLN1)
Enzymes [BR:ptr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     465082 (TLN1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
9
AA seq 2548 aa AA seqDB search
MVALSLKISIGNVVKTMQFEPSTMVYDACRIIRERIPEAPAGPPSDFGLFLSDDDPKKGI
WLEAGKALDYYMLRNGDTMEYRKKQRPLKIRMLDGTVKTIMVDDSKTVTDMLMTICARIG
ITNHDEYSLVRELMEEKKEEITGTLRKDKTLLRDEKKMEKLKQKLHTDDELNWLDHGRTL
REQGVEEHETLLLRRKFFYSDQNVDSRDPVQLNLLYVQARDDILNGSHPVSFDKACEFAG
FQCQIQFGPHNEQKHKAGFLDLKDFLPKEYVKQKGERKIFQAHKNCGQMSEIEAKVRYVK
LARSLKTYGVSFFLVKEKMKGKNKLVPRLLGITKECVMRVDEKTKEVIQEWNLTNIKRWA
ASPKSFTLDFGDYQDGYYSVQTTEGEQIAQLIAGYIDIILKKKKSKDHFGLEGDEESTML
EDSVSPKKSTVLQQQYNRVGKVEHGSVALPAIMRSGASGPENFQVGSMPPAQQQITSGQM
HRGHMPPLTSAQQALTGTINSSMQAVQAAQATLDDFDTLPPLGQDAASKAWRKNKMDESK
HEIHSQVDAITAGTASVVNLTAGDPAETDYTAVGCAVTTISSNLTEMSRGVKLLAALLED
EGGSGRPLLQAAKGLAGAVSELLRSAQPASAEPRQNLLQAAGNVGQASGELLQQIGESDT
DPHFQDVLMQLAKAVASAAAALVLKAKSVAQRTEDSGLQTQVIAAATQCALSTSQLVACT
KVVAPTISSPVCQEQLVEAGRLVAKAVEGCVSASQAATEDGQLLRGVGAAATAVTQALNE
LLQHVKAHATGAGPAGRYDQATDTILTVTENIFSSMGDAGEMVRQARILAQATSDLVNAI
KADAEGESDLENSRKLLSAAKILADATAKMVEAAKGAAAHPDSEEQQQRLREAAEGLRMA
TNAAAQNAIKKKLVQRLEHAAKQAAASATQTIAAAQHAASTPKASAGPQPLLVQSCKAVA
EQIPLLVQGVRGSQAQPDSPSAQLALIAASQSFLQPGGKMVAAAKASVPTIQDQASAMQL
SQCAKNLGTALAELRTAAQKAQEACGPLEMDSALSVVQNLEKDLQEVKAAARDGKLKPLP
GETMEKCTQDLGNSTKAVSSAIAQLLGEVAQGNENYAGIAARDVAGGLRSLAQAARGVAA
LTSDPAMQAIVLDTASDVLDKASSLIEEAKKAAGHPGDPESQQRLAQVAKAVTQALNRCV
SCLPGQRDVDNALRAVGDASKRLLSDSLPPSTGTFQEAQSRLNEAAAGLNQAATELVQAS
RGTPQDLARASGRFGQDFSTFLEAGVEMAGQAPSQEDRAQVVSNLKGISMSSSKLLLAAK
ALSTDPAAPNLKSQLAAAARAVTDSINQLITMCTQQAPGQKECDNALRELETVRELLENP
VQPINDMSYFGCLDSVMENSKVLGEAMTGISQNAKNGNLPEFGDAISTASKALCGFTEAA
AQAAYLVGVSDPNSQAGQQGLVEPTQFARANQAIQMACQSLGEPGCTQAQVLSAATIVAK
HTSALCNSCRLASARTTNPTAKRQFVQSAKEVANSTANLVKTIKALDGAFTEENRAQCRA
ATAPLLEAVDNLSAFASNPEFSSIPAQISPEGRAAMEPIVISAKTMLESAGGLIQTARAL
AVNPRDPPSWSVLAGHSRTVSDSIKKLITSMRDKAPGQLECETAIAALNSCLRDLDQASL
AAVSQQLAPREGISQEALHTQMLTAVQEISHLIEPLANAARAEASQLGHKVSQMAQYFEP
LTLAAVGAASKTLSHPQQMALLDQTKTLAESALQLLYTAKEAGGNPKQAAHTQEALEEAV
QMMTEAVEDLTTTLNEAASAAGVVGGMVDSITQAINQLDEGPMGEPEGSFVDYQTTMVRT
AKAIAVTVQEMVTKSNTSPEELGPLANQLTSDYGHLASEAKPAAVAAENEEIGSHIKHRV
QELGHGCAALVTKAGALQCSPSDAYTKKELIECARRVSEKVSHVLAALQAGNRGTQACIT
AASAVSGIIADLDTTIMFATAGTLNREGTETFADHREGILKTAKVLVEDTKVLVQNAAGS
QEKLAQAAQSSVATITRLADVVKLGAASLGAEDPETQVVLINAVKDVAKALGDLISATKA
AAGKVGDDPAVWQLKNSAKVMVTNVTSLLKTVKAVEDEATKGTRALEATTEHIRQELAVF
CSPEPPAKTSTPEDFIRMTKGITMATAKAVAAGNSCRQEDVIATANLSRRAIADMLRACK
EAAYHPEVAPDVRLRALHYGRECANGYLELLDHVLLTLQKPSPELKQQCQGLMILTMLPG
AFDLPTLPXPLSSSFIPPGTEWVDPEDPTVIAENELLGAAAAIEAAAKKLEQLKPRAKPK
EADESLNFEEQILEAAKSIAAATSALVKAASAAQRELVAQGKVGAIPANALDDGQWSQGL
ISAARMVAAATNNLCEAANAAVQGHASQEKLISSAKQVAASTAQLLVACKVKADQDSEAM
KRLQAAGNAVKRASDNLVKAAQKAAAFEEQENETVVVKEKMVGGIAQIIAAQEEMLRKER
ELEEARKKLAQIRQQQYKFLPSELRDEH
NT seq 7647 nt NT seq  +upstreamnt  +downstreamnt
atggttgcactttcactgaagatcagcattgggaatgtggtgaagacgatgcagtttgag
ccgtctaccatggtgtacgacgcctgccgcatcattcgtgagcggatcccagaggcccca
gctggtcctcccagcgactttgggctctttctgtcagatgatgaccccaaaaagggtata
tggctggaggctgggaaagctttggactactacatgctccgaaatggggacactatggag
tacaggaagaaacagagacccctgaagatccgtatgctggatggaactgtgaagacgatc
atggtggatgactctaagactgtcactgacatgctcatgaccatctgtgcccgcattggc
atcaccaatcatgatgaatattctttggttcgggagctgatggaagagaaaaaggaggaa
ataacagggaccttaagaaaggacaagacattgctgcgagatgaaaagaagatggagaaa
ctaaagcagaaattgcacacagatgatgagttgaactggctggaccatggtcggacactg
agggagcagggtgtagaggaacacgagacgctgctgctgcggaggaagttcttttactca
gaccagaatgtggattcccgggaccctgtacagctgaacctcctgtatgtgcaggcacga
gatgacatcctgaatggctcccaccctgtctcctttgacaaggcctgtgagtttgctggc
ttccaatgccagatccagtttgggccccacaatgagcagaagcacaaggctggcttcctc
gacctgaaggacttcctgcccaaggagtatgtgaagcagaagggagagcgtaagatcttc
caggcacacaagaattgtgggcagatgagtgagattgaggccaaggtccgctacgtgaag
ctagcccgttctctcaagacttacggtgtctccttcttcctggtgaaggaaaaaatgaaa
gggaagaacaagctagtgcccaggcttctgggcatcaccaaggagtgtgtgatgcgagtg
gatgagaagaccaaggaagtgatccaggagtggaacctcaccaacatcaaacgctgggct
gcgtctcccaaaagcttcaccctggattttggagattaccaagatggctattactcagta
cagacaactgaaggggagcagattgcacagctcattgccggctacatcgatatcatcctg
aagaagaaaaaaagcaaggatcactttgggctggaaggagatgaggagtctactatgctg
gaggactcagtgtcccccaaaaagtcaacagtcctgcagcagcaatacaaccgggtgggg
aaagtggagcatggctctgtggccctgcctgccatcatgcgctctggagcctctggtccc
gagaatttccaggtgggcagcatgccccctgcccagcagcagattaccagcggccagatg
caccgaggacacatgcctcctctgacttcagcccagcaggcactcactggaaccattaac
tccagcatgcaggccgtgcaggctgcccaggccaccctggatgactttgacactctgccg
cctcttggccaggatgctgcctctaaggcctggcgtaaaaacaagatggatgaatcaaag
catgagatccactctcaggtagatgccatcacagctggtactgcatctgtggtgaacctg
acagcaggggaccctgctgagacagactataccgcagtgggctgtgcagtcaccacaatc
tcctccaacctgacggagatgtcccgtggggtgaagctgctggctgccttgctggaggac
gaaggcggcagtggccggcccctgttgcaggcagcaaagggccttgcgggagcagtgtca
gaactgctgcgcagtgcccaaccagccagtgctgagccccgtcagaacctgctgcaagca
gctgggaacgtgggccaggccagtggggagctgttgcaacaaattggggaaagtgatact
gacccccacttccaggatgtgctaatgcagctcgccaaagctgtggcaagtgctgcagct
gccctcgtcctcaaggccaagagtgtggcccagcggacagaggactcgggacttcagacc
caagttattgctgcagcaacacagtgtgccctatccacttcccaactagtggcctgtact
aaggtggtggcacctacaatcagctcacctgtctgccaagagcaactggtggaggctgga
cgactggtagccaaagccgtggagggctgtgtgtctgcctcccaggcagctacagaggat
gggcaactgttgcgaggggtaggagcagcagccacagctgtcacccaggccctaaatgag
ctgctgcagcatgtgaaagcccatgccacaggggctgggcctgctggccgttatgaccag
gctactgacaccatcctaaccgtcactgagaacatctttagctccatgggtgatgctggg
gagatggtgcgacaggcccgcatcctggcccaagccacatctgacctggtcaatgccatc
aaggctgatgctgagggggaaagtgatctcgagaactcccgcaagctcttaagtgctgcc
aagatcctagctgatgccacagccaagatggtagaggctgccaagggagcagccgcccac
cctgacagtgaggagcagcagcagcggctgcgggaggcagctgaggggctgcgcatggcc
accaatgcagccgcgcagaatgccatcaagaaaaagctggtgcagcgcctggagcatgca
gccaagcaggctgcagcctcagccacacagaccatcgctgcagctcaacatgcagcctct
acccccaaggcctctgccggcccccagcccctgctggtgcagagctgcaaggcagtggca
gagcagattccactgctggtgcaaggtgtccgaggaagccaagcccagcctgacagcccc
agcgctcagcttgccctcattgctgccagccagagcttcctgcagccaggtgggaagatg
gtggcagctgcaaaggcctcagtgccaacgattcaggaccaggcttcagccatgcagctg
agtcagtgtgccaagaacctgggcaccgcattggctgaactccggacggctgcccagaag
gctcaggaagcatgtggacctttggagatggattctgcactgagtgtggtacagaatcta
gagaaagatctacaggaagtgaaggcagcagctcgagatggcaagcttaaacccttacct
ggggagacaatggagaagtgtacccaggacctgggcaacagcaccaaagccgtgagctca
gccatcgcccagctactgggagaggttgcccagggcaatgagaattatgcaggtattgca
gctcgggatgtggcaggtgggctgcggtcactggcccaggccgctaggggagtcgctgca
ctgacgtcagatcctgcaatgcaggccattgtacttgatacggccagtgatgtgctggac
aaggccagcagcctcattgaggaggcgaaaaaggcagctggccatccaggggaccctgag
agccagcagcggcttgcccaggtggctaaagcagtgacccaggctctgaaccgctgtgtc
agctgcctacctggccagcgcgatgtggataatgccctgagggcagttggagatgccagc
aagcgactcctgagtgactcgcttcctcctagcactgggacatttcaagaagctcagagc
cggttgaatgaagctgctgctgggctgaatcaggcagccacagaactggtgcaggcctct
cggggaacccctcaggacctggctcgagcctcaggccgatttggacaggacttcagcacc
ttcctggaagctggtgtggagatggcaggccaggctccgagccaggaggaccgagcccaa
gttgtgtccaacttgaagggcatctccatgtcttcaagcaaacttcttctggctgccaag
gccctgtccacggaccctgctgcccctaacctcaagagtcagctggctgcagctgccagg
gcagtaactgacagcatcaatcagctcatcactatgtgcacccagcaggcacccggccag
aaggagtgtgataacgccctgcgggaattggagacggtccgggaactcctggagaaccca
gtccagcccatcaatgacatgtcctactttggttgtctggacagtgtaatggagaactca
aaggtgctgggcgaggccatgactggcatctcccaaaatgccaagaacggaaacctgcca
gagtttggagatgccatttccacagcctcaaaggcactttgtggcttcaccgaggcagct
gcacaggctgcatatctggttggtgtctctgaccccaatagccaagctggacagcaaggg
ctagtggagcccacacagtttgcccgtgcaaaccaggcaattcagatggcctgccagagt
ttgggagagcctggctgtacccaggcccaggtgctctccgcagccaccattgtggctaaa
cacacctctgcgctgtgtaacagctgtcgcctggcttctgcccgtaccaccaatcctact
gccaagcgccagtttgtacagtcagccaaggaggtggccaacagcacagctaatcttgtc
aagaccatcaaggcgctagatggggccttcacagaggagaaccgtgcccagtgccgagca
gcaacagcccctctgctggaggctgtggacaatctgagtgcctttgcgtccaaccctgag
ttctccagcattcctgcccagatcagccctgagggtcgggctgccatggagcccattgtg
atctctgccaagacaatgttagagagtgccgggggactcatccagacagcccgggccctc
gcagtcaatccccgggaccccccgagctggtcggtgctggccggccactcccgtactgtc
tcagactccatcaagaagctaattacaagcatgagggacaaggctccagggcagctggag
tgtgaaacggccattgcagctctgaacagttgtctacgggacctagaccaggcttctctc
gctgcagtcagccagcagcttgctccccgtgagggaatctctcaagaggccttgcacact
cagatgctcactgcagtacaagagatctcccatctcattgagccgctggccaatgctgcc
cgggctgaagcctcccagctgggacacaaggtgtcccagatggcccagtactttgagccg
ctcaccctggctgcagtgggtgctgcctccaagaccctgagccacccgcagcagatggca
ctcctggaccagactaaaacattggcagagtctgccctgcagttgctatacactgccaag
gaggctggtggtaacccaaagcaagcagctcacacccaggaagccctggaggaggctgtg
cagatgatgaccgaggccgtagaggacctgacaacaaccctcaacgaggcagccagtgct
gctggggtcgtgggtggcatggtggactccatcacccaggccatcaaccagctagatgaa
ggaccaatgggtgaaccagaaggttccttcgtggattaccaaacaactatggtgcggaca
gccaaggccattgcagtgaccgttcaggagatggttaccaagtcaaacaccagcccagag
gagctgggccctcttgctaaccagctgaccagtgactatggccatctggcctcggaggcc
aagcctgcagcggtggctgctgaaaatgaagagataggttcccatatcaaacaccgggta
caggagctgggccatggctgtgccgctctggtcaccaaggcaggcgccctgcagtgcagc
cccagtgatgcctacaccaagaaggagctcatagagtgtgcccggagagtctctgagaag
gtctcccacgtcctggctgcgctccaggctgggaatcgtggcacccaggcctgcatcaca
gcagccagcgctgtgtctggtatcattgctgacctcgacaccaccatcatgttcgccact
gctggcacgctcaatcgtgagggtactgaaactttcgctgaccaccgggagggcatcctg
aagactgcgaaggtgctggtggaggacaccaaggtcctggtgcaaaacgcagctgggagc
caggagaagttggcgcaggctgcccagtcctccgtggcgaccatcacccgcctcgctgat
gtggtcaagctgggtgcagccagcctgggagctgaggaccctgagacccaggtggtacta
atcaacgcagtgaaagatgtagccaaagccctgggagacctcatcagtgcaacgaaggct
gcagctggcaaagttggagatgaccctgctgtgtggcagctaaagaactctgccaaggtg
atggtgaccaatgtgacatcattgcttaagacagtaaaagccgtggaagatgaggccacc
aaaggcactcgggccctggaggcaaccacagaacacatacggcaggagctggcggttttc
tgttccccagagccacctgccaagacctctaccccagaagacttcatccgaatgaccaag
ggtatcaccatggcaacagccaaggccgttgctgctggcaattcctgtcgccaggaagat
gtcattgccacagccaatctgagccgccgtgctattgcagatatgcttcgggcttgcaag
gaagcagcttaccacccagaagtggcccctgatgtgcggcttcgagccctgcactatggc
cgggagtgtgccaatggctacctggaactgctggaccatgtactgctgaccctgcagaag
ccaagcccagaactgaagcagcaatgccagggcctgatgatactaaccatgctgcctggt
gcttttgacctccccactctgccttagcctctttcctcttccttcatcccaccaggaaca
gaatgggtagacccagaggaccccacagtcattgctgagaatgagctcctgggagctgca
gccgccattgaggctgcagccaaaaagctagagcagctgaagccccgggccaaacctaag
gaggcagatgagtccttgaactttgaggagcagatactagaagctgccaagtccattgca
gcagccaccagtgcactggtaaaggctgcgtcggctgcccagagagaactagtggcccaa
gggaaggtgggtgccattccagccaatgcactggatgatgggcagtggtcccagggcctc
atttctgctgcccggatggtggctgcggccaccaacaatctgtgtgaggcagccaatgca
gctgtacaaggccatgccagccaggagaagctcatctcatcagccaagcaggtagctgcc
tccacagcccagctccttgtggcctgcaaggtcaaggctgaccaggactcagaggcaatg
aaacgacttcaggctgctggcaacgcagtgaagcgagcctcagataatctggtgaaagca
gcacagaaggctgcagccttcgaagagcaggagaatgagacagtggtggtgaaagagaag
atggttggcggcattgcccagatcatcgcagcacaggaagaaatgcttcggaaggaacga
gagctggaagaggcgcggaagaaactggcccagatccggcagcagcagtacaagtttctg
ccttcagagcttcgagatgagcactaa

DBGET integrated database retrieval system