KEGG   Pan troglodytes (chimpanzee): 465145Help
Entry
465145            CDS       T01005                                 

Gene name
GPT2
Definition
glutamic pyruvate transaminase (alanine aminotransferase) 2
Orthology
K00814  
alanine transaminase [EC:2.6.1.2]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Carbon metabolism
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ptr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    465145 (GPT2)
   01210 2-Oxocarboxylic acid metabolism
    465145 (GPT2)
   01230 Biosynthesis of amino acids
    465145 (GPT2)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    465145 (GPT2)
Enzymes [BR:ptr01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     465145 (GPT2)
Amino acid related enzymes [BR:ptr01007]
 Aminotransferase (transaminase)
  Class I
   465145 (GPT2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
16
AA seq 523 aa AA seqDB search
MQRAAALVRRGCGPRTPSSWGRSQSSAAAEASAVLKVRPERSRRERILTLESMNPQVKAV
EYAVRGPIVLKAGEIELELQRGIKKPFTEVIRANIGDAQAMGQQPITFLRQVMALCTYPN
LLDSPSFPEDAKKRARRILQACGGNSLGSYSASQGVNCIREDVAAYXXXXDGGVLAGPVN
IYLTAGASDGISTILKILVSGGGKSRTGVMIPIPQYPLYSAVISELDAIQVNYYLDEENC
WALNVNELRRAVQEAKDHCDPKVLCIINPGNPTGQVQSRKCIEDVIHFAWEEKLFLLADE
VYQDNVYSPDCRFHSFKKVLYEMGPEYSSNVELASFHSTSKGYMGECGYRGGYMEVINLH
PEIKGQLVKLLSVRLCPPVSGQAAMDIVVNPPVAGEESFEQFSREKESVLGNLARKAKLT
EDLFNQVPGIHCNPLQGAMYAFPRIFIPAKAVEAAQAHQMAPDMFYCMKLLEETGICVVP
GSGFGQREGTYHFRMTILPPVEKLKTVLQKVKDFHINFLEKYA
NT seq 1572 nt NT seq  +upstreamnt  +downstreamnt
atgcagcgggcggcggcgctggtccggcggggctgtggtccccggacccccagctcctgg
ggccgcagccagagcagcgcggccgccgaggcctcggcggtgctcaaggtgcggcccgag
cgcagccggcgcgagcgcatcctcacgctggagtccatgaacccgcaggtgaaggcggtg
gagtacgccgtgcggggacccatcgtgctcaaggccggcgagatcgagctcgagctgcag
cggggtatcaaaaagccattcacagaggtcatccgagccaacatcggggacgcccaggct
atggggcagcagccaatcaccttcctccggcaggtgatggcactatgcacctacccaaac
ctgctggacagccccagcttcccagaagatgctaagaaacgtgcccggcggatcctgcag
gcttgtggcgggaacagcctggggtcctacagtgctagccagggtgtcaactgcatccgt
gaagacgtggctgcctacnnnnnnnnnngggatggcggtgtgcttgcgggccccgtcaac
atctacctgaccgcgggagctagtgacggcatttctacgatcctgaagatcctcgtctcc
gggggtggcaagtcacggacaggtgtgatgatccccatcccacaatatcccctctattca
gctgttatctctgagctcgacgccatccaggtgaattactacctggacgaggagaactgc
tgggcgctgaatgtgaatgagctccggcgggcggtgcaggaggccaaagaccactgtgac
cctaaggtgctctgcataatcaaccctgggaaccccacaggccaggtacaaagcagaaag
tgcatagaagatgtgatccactttgcctgggaagagaagctctttctcctggctgatgag
gtgtaccaggacaacgtgtactctccagattgcagattccactccttcaagaaggtgctg
tacgagatggggcccgagtactccagcaacgtggagctcgcctccttccactccacctcc
aagggctacatgggcgagtgtggttacagaggaggctacatggaggtgatcaacctgcac
cctgagatcaagggccagctggtgaagctgctgtcggtgcgcctgtgccccccagtgtct
gggcaggccgccatggacattgtcgtgaaccccccggtggcaggagaggagtcctttgag
caattcagccgagagaaggagtcagtcctgggtaatctggccagaaaagcaaagctgacg
gaagacctgtttaaccaagtcccaggaattcactgcaaccccttgcagggggccatgtac
gccttccctcggatcttcattcctgccaaagctgtggaggctgctcaggcccatcaaatg
gctccagacatgttctactgcatgaagctcctggaggagactggcatctgtgtcgtgccc
ggcagtggttttgggcagagggaaggcacttaccacttcaggatgactatcctccctcca
gtggagaagctgaaaacggtgctgcagaaggtgaaagacttccacatcaacttcctggag
aagtacgcgtga

DBGET integrated database retrieval system