KEGG   Pan troglodytes (chimpanzee): 465165Help
Entry
465165            CDS       T01005                                 

Gene name
CYLD
Definition
cylindromatosis (turban tumor syndrome)
Orthology
K08601  
ubiquitin thioesterase CYLD [EC:3.1.2.15]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
Osteoclast differentiation
RIG-I-like receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:ptr00001]
 Organismal Systems
  Immune system
   04622 RIG-I-like receptor signaling pathway
    465165 (CYLD)
  Development
   04380 Osteoclast differentiation
    465165 (CYLD)
Enzymes [BR:ptr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     465165 (CYLD)
Peptidases [BR:ptr01002]
 Cysteine Peptidases
  Family C67
   465165 (CYLD)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
16
AA seq 959 aa AA seqDB search
MSSGLWSQEKVTSPYWEERIFYLLLQECSVTDKQTQKLLKVPKGSIGQYIQDRSVGHSRI
PSAKGKKNQIGLKILEQPHAVLFVDEKDVVEINEKFTELLLAITNCEERFSLFKNRNRLS
KGLQIDVGCPVKVQLRSGEEKFPGVVRFRGPLLAERTVSGIFFGVELLEEGRGQGFTDGV
YQGKQLFQCDEDCGVFVALDKLELIEDDDTALESDYAGPGDTMQVELPPLEINSRVSLKV
GETIESGTVIFCDVLPGKESLGYFVGVDMDNPIGNWDGRFDGVQLCSFACVESTILLHIN
DIIPALSESVTQERRPPKLAFMSRGVGDKGSSSHNKPKATGSTSDPGNRNRSELFYTLNG
SSVDSQPQSKSKNTWYIDEVAEDPAKSLTEISTDFDRSSPPLQPPPVNSLTTENRFHSLP
FSLTKMPNTNGSIGHSPLSLSAQSVMEELNTAPVQESPPLAMPPGNSHGLEVGSLAEVKE
NPPFYGVIRWIGQPPGLNEVLAGLELEDECAGCTDGTFRGTRYFTCALKKALFVKLKSCR
PDSRFASLQPVSNQIERCNSLAFGGYLSEVVEENTPPKMEKEGLEIMIGKKKGIQGHYNS
CYLDSTLFCLFAFSSVLDTVLLRPKEKNDVEYYSETQELLRTEIVNPLRIYGYVCATKIM
KLRKILEKVEAASGFTSEEKDPEEFLNIVFHLINRLYVFFSLRVFRSAGQKVQDCYFYQI
FMEKNEKVGVPTIQQLLEWSFINSNLKFAEAPSCLIIQMPRFGKDFKLFKKIFPSLELNI
TDLLEDTPRQCRICGGLAMYECRECYDDPDISAGKIKQFCKTCNTQVHLHPKRLNHKYNP
VSLPKDLPDWDWRHGCIPCQNMELFAVLCIETSHYVAFVKYGKDDSAWLFFDSMADRDGG
QNGFNIPQVTPCPEVGEYLKMSLEDLHSLDSRRIQGCARRLLCDAYMCMYQSPTMSLYK
NT seq 2880 nt NT seq  +upstreamnt  +downstreamnt
atgagttcaggcttatggagccaagaaaaagtcacttcaccctactgggaagagcggatt
ttttacttgcttcttcaagaatgcagcgttacagacaaacaaacacaaaagctccttaaa
gtaccgaagggaagtataggacagtatattcaagatcgttctgtggggcattcaaggatt
ccttctgcaaaaggcaagaaaaatcagattggattaaaaattctagagcaacctcatgca
gttctctttgttgatgaaaaggatgttgtagagataaatgaaaagttcacagagttactt
ttggcaattaccaattgtgaggagaggttcagcctgtttaaaaacagaaacagactaagt
aaaggcctccaaatagacgtgggctgtcctgtgaaagtacagctgagatctggggaagaa
aaatttcctggagttgtacgcttcagaggacccctcttagcagagaggacagtctccgga
atattctttggagttgaattgctggaagaaggtcgtggtcaaggtttcactgacggggtg
taccaagggaaacagctttttcagtgtgatgaagattgtggcgtgtttgttgcattggac
aagctagaactcatagaagatgatgacactgcattggaaagtgattacgcaggtcctggg
gacacaatgcaggtcgaacttcctcctttggaaataaactccagagtttctttgaaggtt
ggagaaacaatagaatctggaacagttatattctgtgatgttttgccaggaaaagaaagc
ttaggatattttgttggtgtggacatggataaccctattggcaactgggatggaagattc
gatggagtgcagctttgtagttttgcatgtgttgaaagtacaattctattgcacatcaat
gatatcatcccagctttatcagagagcgtgacacaggaaaggaggcctcccaaacttgcc
tttatgtcaagaggtgttggggacaaaggttcatccagtcataataaaccaaaggctaca
ggatctacctcagaccctggaaatagaaacagatctgaattattttataccttaaatggg
tcttctgttgactcacaaccacaatccaaatcaaaaaatacatggtacattgatgaagtt
gcagaagaccctgcaaaatctcttacagagatatctacagactttgaccgttcttcacca
ccactccagcctcctcctgtgaactcactgaccaccgagaacagattccactctttacca
ttcagtctcaccaagatgcccaataccaatggaagtattggccacagtccactttctctg
tcagcccagtctgtaatggaagagctaaacactgcacccgtccaagagagtccacccttg
gccatgcctcctgggaactcacatggtctagaagtgggctcattggctgaagttaaggag
aaccctcctttctatggagtaatccgttggatcggtcagccaccaggactgaatgaagtg
ctcgctggactggaactggaagatgagtgtgcaggctgtacggatggaaccttcagaggc
actcggtatttcacctgtgccctgaagaaggcgctgtttgtgaaactgaagagctgcagg
cctgactctaggtttgcatcattgcagccggtttccaatcagatcgagcgctgtaactct
ttagcatttggaggctacttaagtgaagtagtagaagaaaatactccaccaaaaatggaa
aaagaaggcttggagataatgattgggaagaagaaaggcatccagggtcattacaattct
tgttacttagactcaaccttattctgcttatttgcttttagttctgttctggacactgtg
ttacttagacccaaagaaaagaacgatgtagaatattatagtgaaacccaagagctactg
aggacagaaattgttaatcctctgagaatatatggatatgtgtgtgccacaaaaattatg
aaactgaggaaaatacttgaaaaggtggaggctgcatcaggatttacctctgaagaaaaa
gatcctgaggaatttcttaatattgtatttcatttgataaataggttgtatgtatttttt
tctctgcgtgtttttagatcagcaggtcaaaaggtacaagattgttacttctatcaaatt
tttatggaaaaaaatgagaaagttggcgttcccacaattcagcagttgttagaatggtct
tttatcaacagtaacctgaaatttgcagaggcaccatcatgtctgattattcagatgcct
cgatttggaaaagactttaaactatttaaaaaaatttttccttctctggaattaaatata
acagatttacttgaagacactcccagacagtgccggatatgtggagggcttgcaatgtat
gagtgtagagaatgctacgacgatccggacatctcagctggaaaaatcaagcagttttgt
aaaacctgcaacactcaagtccaccttcatccgaagaggctgaatcataaatataaccca
gtgtcacttcccaaagacttacctgactgggactggagacacggctgcatcccttgccag
aatatggagttatttgctgttctctgcatagaaacaagccactatgttgcttttgtgaag
tatgggaaggacgattccgcctggctcttctttgacagcatggccgatcgggatggtggt
cagaacggcttcaacattcctcaagtcaccccatgcccagaagtaggagagtacttgaag
atgtctctggaagacctgcattccttggactccaggagaatccaaggctgtgcacgaaga
ctgctttgtgatgcatatatgtgcatgtaccagagtccaacaatgagtttgtacaaataa

DBGET integrated database retrieval system