KEGG   Pan troglodytes (chimpanzee): 465207Help
Entry
465207            CDS       T01005                                 

Gene name
RNASE1, RAC1
Definition
ribonuclease, RNase A family, 1 (pancreatic) (EC:3.1.27.5)
Orthology
K01168  
pancreatic ribonuclease [EC:3.1.27.5]
Organism
ptr  Pan troglodytes (chimpanzee)
Brite
Enzymes [BR:ptr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.27  Endoribonucleases producing 3'-phosphomonoesters
    3.1.27.5  pancreatic ribonuclease
     465207 (RNASE1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
14
AA seq 156 aa AA seqDB search
MALEKSLVLLPLLVLILLVLGWVQPSLGKESRAKKFQRQHVDSDSSPSSSSTYCNQMMRR
RNMTQGRCKPVNTFVHEPLVDVQNVCFQEKVTCKNGQGNCYKSNSSMHITDCRLTNGSRY
PNCAYRTSPKERHIIVACEGSPYVPVHFDASVEDST
NT seq 471 nt NT seq  +upstreamnt  +downstreamnt
atggctctggagaagtctcttgtcctgctccctctgcttgtcctgatactgctggtgctg
ggctgggtccagccttccctgggcaaggaatcccgggccaagaaattccagcggcagcat
gtggactcagacagttcccccagcagcagctccacctactgtaaccaaatgatgaggcgc
cggaatatgacacaggggcggtgcaaaccagtgaacacctttgtgcacgagcccctggta
gatgtccagaatgtctgtttccaggaaaaggtcacctgcaagaacgggcagggcaactgc
tacaagagcaactccagcatgcacatcacagactgccgcctgacaaacggctccaggtac
cccaactgtgcataccggaccagcccgaaggagagacacatcattgtggcctgtgaaggg
agcccatatgtgccggtccacttcgatgcttctgtggaggactccacctaa

DBGET integrated database retrieval system