KEGG   Pan troglodytes (chimpanzee): 465336Help
Entry
465336            CDS       T01005                                 

Gene name
GYS2
Definition
(RefSeq) glycogen synthase 2 (liver)
  KO
K00693  
glycogen(starch) synthase [EC:2.4.1.11]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
Starch and sucrose metabolism
PI3K-Akt signaling pathway
AMPK signaling pathway
Insulin signaling pathway
Glucagon signaling pathway
Insulin resistance
Brite
KEGG Orthology (KO) [BR:ptr00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    465336 (GYS2)
 Environmental Information Processing
  Signal transduction
   04151 PI3K-Akt signaling pathway
    465336 (GYS2)
   04152 AMPK signaling pathway
    465336 (GYS2)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    465336 (GYS2)
   04922 Glucagon signaling pathway
    465336 (GYS2)
 Human Diseases
  Endocrine and metabolic diseases
   04931 Insulin resistance
    465336 (GYS2)
Enzymes [BR:ptr01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     465336 (GYS2)
Glycosyltransferases [BR:ptr01003]
 Polysaccharide
  Storage polysaccharide
   465336 (GYS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
Position
12
AA seq 676 aa AA seqDB search
MLRGRSLSVTSLGGLPQWEVEELPVEELLLFEVAWEVTNKVGGIYTVIQTKAKTTADEWG
ENYFLIGPYFEHNMKTQVEQCEPVNDAVRRAVDAMNKHGCQVHFGRWLIEGSPYVVLFDI
GYSAWNLDRWKGDLWEACSVGIPYHDREANDMLIFGSLTAWFLKEVTDHADGKHVVAQFH
EWQAGIGLILSRARKLPIATIFTTHATLLGRYLCAANIDFYNHLDKFNIDKEAGERQIYH
RYCMERASVHCAHVFTTVSEITAIEAEHMLKRKPDVVTPNGLNVKKFSAVHEFQNLHAMY
KARIQDFVRGHFYGHLDFDLEKTLFLFIAGRYEFSNKGADIFLESLSRLNFLLRMHKSDI
TVVVFFIMPAKTNNFNVETLKGQAVRKQLWDVAHSVKEKFGKKLYDALLRGEIPDLNDIL
DRDDLTIMKRAIFSTQRQSLPPVTTHNMIDDSTDPILSTIRRIGLFNNRTDRVKVILHPE
FLSSTSPLLPMDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSVTTNLSGFGCFMQE
HVADPTAYGIYIVDRRFRSPDDSCNQLTKFLYGFCKQSRRQRIIQRNRTERLSDLLDWRY
LGRTEGFKYPRPSSVPPSPSGSQASSPQSSDVEDEVEDERYDEEEEAERDRLNIKSPFSL
SHVPHGKKKLHGEYKN
NT seq 2031 nt NT seq  +upstreamnt  +downstreamnt
atgcttcgaggccgatccctgtctgtaacatccctgggtgggcttccccagtgggaagtc
gaagaacttcctgtggaggagttactgctctttgaagttgcttgggaagtgaccaataaa
gttggaggcatctatactgtgattcagacaaaggccaaaacaacagcagatgaatgggga
gagaactattttctgataggtccatattttgagcataatatgaagactcaggtggaacag
tgtgaacctgtaaatgatgctgtcagaagagcagtggatgcaatgaataagcatggctgc
caggtgcattttggaagatggctgatagaaggaagtccttatgtggtgctttttgacata
ggctattcagcttggaatctggacaggtggaagggtgacctctgggaagcatgcagtgtc
ggcattccttatcatgaccgagaagccaatgatatgctgatatttggatctttaactgcc
tggttcttaaaagaggtgacagatcatgcagatggtaaacatgtcgttgcccaattccat
gaatggcaggctggaattggactgatcctttctcgagccaggaaacttcctattgccaca
atatttacaacccacgctacactacttgggaggtatctctgtgcagcaaatattgatttc
tacaaccatcttgataagtttaacattgacaaagaggctggggaaaggcagatttaccac
cggtactgcatggagcgagcttccgttcattgcgctcacgtgttcaccacggtttctgaa
ataacagcaatagaggctgaacatatgctgaagagaaagcctgatgtagttactccaaac
ggcttgaatgttaagaaattttcagcagtgcatgagtttcaaaatctacatgccatgtac
aaggccagaatccaagattttgttcgaggtcatttctatggtcatctcgactttgatctt
gaaaagactttgttccttttcattgctgggaggtatgagttttcaaacaaaggagctgac
atcttcctagaatccttatccaggctaaatttcctgctgaggatgcataaaagtgacatc
acagtggtggtgtttttcattatgcctgccaagacaaataatttcaacgtggaaaccctg
aaaggacaagcagtgcgaaaacagctgtgggatgttgcacattctgtgaaggaaaagttt
ggaaaaaaactctatgatgcattattaagaggagaaattcctgacctgaacgatatttta
gatcgagatgatctaacaattatgaaaagagccatcttttcaactcagcgacagtcattg
cccccagtgaccacgcacaacatgattgatgactccaccgaccccatcctcagcaccatt
agacggattggacttttcaacaaccgcacagatagagtcaaggtgattttgcacccagag
tttctatcctccaccagtcccttactacccatggactatgaagagtttgttagaggttgt
catcttggagtatttccatcatactatgaaccctggggttatactccagctgaatgcact
gtgatgggtatccccagtgtgaccacgaatctctccgggtttggctgtttcatgcaggag
cacgtggctgatcctactgcttacggtatttacatcgttgacaggcggttccgttctcca
gatgattcttgcaatcagctgactaagtttctctatggattttgcaaacagtcacgccgc
caaaggattatccagaggaacagaactgagaggctctcagatcttctggattggagatac
ttaggcagaacagaaggatttaaatatcccaggccttcctcagtaccaccttctccttca
gggtctcaggcctccagtcctcagagcagtgatgtggaagatgaagtggaggatgagaga
tacgatgaggaagaggaggctgaaagggatcggttaaatatcaagtcaccattttcactg
agccacgttcctcatgggaagaaaaagctgcatggtgaatataagaactga

DBGET integrated database retrieval system