KEGG   Pan troglodytes (chimpanzee): 465493Help
Entry
465493            CDS       T01005                                 

Gene name
TMSB4X
Definition
(RefSeq) thymosin beta 4, X-linked
  KO
K05764  
thymosin, beta 4
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:ptr00001]
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    465493 (TMSB4X)
Cytoskeleton proteins [BR:ptr04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Thymosin
     465493 (TMSB4X)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
X
AA seq 44 aa AA seqDB search
MSDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES
NT seq 135 nt NT seq  +upstreamnt  +downstreamnt
atgtctgacaaacccgatatggctgagatcgagaaattcgataagtcgaaactgaagaag
acagagacgcaagagaaaaatccactgccttccaaagaaacaattgaacaggagaagcaa
gcaggcgaatcgtaa

DBGET integrated database retrieval system