KEGG   Pan troglodytes (chimpanzee): 465604Help
Entry
465604            CDS       T01005                                 

Gene name
USP11
Definition
ubiquitin specific peptidase 11
Orthology
K11835  
ubiquitin carboxyl-terminal hydrolase 4/11/15 [EC:3.1.2.15]
Organism
ptr  Pan troglodytes (chimpanzee)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
X
AA seq 787 aa AA seqDB search
MAVAPRLFGGLCFRFRDQNPEVAVEGRLPISHSCVGCRRERTAMATVAANPAAAAAAVAA
AAAVAEDREPQHKELPGLDSQWRQIENGESGRERPLRAGESWFLVEKHWYKQWEAYVQGG
DQDSSTFPGCINNATLFQDEINWRLKEGLVEGEGYVLLPAAAWHXLVSWYGLEHGQPPIE
RKVIELPNIQKVEVYPVELLLVRHNDLGKSHTVQFSHTDSIGLVLRTARERFLVEPQEDT
RLWAKNSEGSLDRLYDTHITVLDAALETGQLIIMETRKKDGTWPSAQLHVMNNNMSEEDE
DFKGQPGICGLTNLGNTCFMNSALQCLSNVPQLTEYFLNNCYLEELNFRNPLGMKGEIAE
AYADLVKQAWSGHHRSIVPHVFKNKVGHFASQFLGYQQHDSQELLSFLLDGLHEDLNRVK
KKEYVELCDAAGRPDQEVAQEAWQNHKRRNDSVIVDTFHGLFKSTLVCPDCGNVSVTFDP
FCYLSVPLPISHKRVLEVFFIPMDPRRKPEQHRLVVPKKGKISDLCVALSKHTGISPERM
MVADVFSHRFYKLYQLEEPLSSILDRDDIFVXVGMAGRWWFLRNLVHFLLYGPAYSGLML
FGHPLLVSVPRYRFTWEGLYNVLIFRLSRYVTKPNSDDEDDGDEKEDDEEDKDDVPGPST
GGSLRDPEPEQAGPSSGVTNRCPFLLDNCLGTSQWPPRRRRKQLFTLQTVNSNGTSDRTT
SPEEVHAQPYIAIDWEPEMKKRYYDEVEAEGYVKHDCVGYVMKKAPVRLQECIELFTTVE
TLEKENP
NT seq 2363 nt NT seq  +upstreamnt  +downstreamnt
atggcagtagccccgcgactgtttggggggctctgcttccgtttccgggaccagaatccg
gaagtggctgttgaggggcgtcttccaatctcgcacagctgcgttggctgtagaagagaa
cggacggcgatggcgacggtcgcagcaaatccagctgctgctgcggcggctgtggcggcg
gcagcggcggtggctgaggatagagagccacagcacaaggagctgccaggcctggacagc
cagtggcgccagatagaaaacggcgagagtgggcgagaacgtccactgcgggccggcgaa
agctggttccttgtggagaagcactggtataagcagtgggaggcatacgtgcagggaggg
gaccaggactccagcaccttccctggctgcatcaacaatgccacactctttcaagatgag
ataaactggcgcctcaaggagggactggtggaaggcgagggatatgtgctgctcccagca
gctgcttggcatntcctggtcagctggtatggtctagagcatggccagccacccattgaa
cgcaaggtcatagagctgcccaacatccagaaggtcgaagtgtacccagtagaactgctg
cttgtccggcacaatgatttgggcaaatctcacactgttcagttcagccataccgattct
attggcctagtattgcgcacagctcgggagcggtttctggtggagccccaggaagacact
cggctttgggccaagaactcagaaggctctttggataggttgtatgacacacacatcacg
gttctcgatgcggcccttgagactgggcagttgatcatcatggagacccgcaagaaagat
ggcacttggcccagcgcacagctgcatgtcatgaacaacaacatgtcggaagaggatgag
gacttcaagggtcagccaggcatctgtggcctcaccaatctgggcaacacgtgcttcatg
aactcggccctgcagtgcctcagcaatgtgccacagctcaccgagtacttcctcaacaac
tgctacctggaggagctcaacttccgcaacccactgggcatgaagggtgagatcgcagag
gcctatgcagacctggtgaagcaggcgtggtctggccaccaccgctccattgtgccacat
gtgttcaagaacaaggttggccattttgcatcccaatttctgggctaccagcagcatgac
tctcaggagctgctgtcattcctcctggacgggctgcatgaggaccttaatcgggtgaag
aagaaggagtatgtggagctgtgcgatgctgctgggcgaccggatcaggaggtggcacag
gaggcatggcaaaaccacaaacggcggaacgattctgtgatcgtggacactttccacggc
ctcttcaagtccacgctggtgtgccccgattgtggcaatgtatctgtgaccttcgacccc
ttctgctacctcagtgttccactgcctatcagccacaagagggtcttggaggtcttcttt
atccccatggatccgcgccgcaagccagagcagcaccggctcgtggtccccaagaaaggc
aagatctcggatctatgtgtggctctgtccaaacacacgggcatctcgccagagaggatg
atggtggctgatgtcttcagtcaccgcttctataagctctatcagctagaggagcctctg
agtagcatcttggaccgtgatgatatcttcgtgtgagtggggatggcagggaggtggtgg
ttcctcaggaacttggtccacttccttttgtatggtcctgcctattccggcctgatgctt
tttggacaccccctcctggtatcagtgccccgttaccgcttcacctgggagggcctgtat
aatgtcctgatcttccggctctcacgctacgtgaccaaacccaactcagatgatgaggac
gatggggatgagaaagaagatgacgaggaggataaagacgacgtccctgggccctcaact
gggggcagcctccgagaccctgagccagagcaggctgggcccagctctggagtcacgaac
aggtgcccgttcctcctggacaattgccttggcacatctcagtggcccccaaggcgacga
cgcaagcagctgttcaccctgcagacggtgaactccaatgggaccagcgaccgcacaacc
tcccctgaagaagtccatgcccagccgtacattgctatcgactgggagccagagatgaag
aagcgttactatgacgaggtagaggctgagggctacgtgaagcatgactgcgtcgggtac
gtgatgaagaaggctcccgtgcggctgcaggagtgcattgagctcttcaccactgtggag
accctggagaaggaaaacccctg

DBGET integrated database retrieval system