KEGG   Pan troglodytes (chimpanzee): 465604Help
Entry
465604            CDS       T01005                                 

Gene name
USP11
Definition
(RefSeq) ubiquitin specific peptidase 11
  KO
K11835  
ubiquitin carboxyl-terminal hydrolase 4/11/15 [EC:3.4.19.12]
Organism
ptr  Pan troglodytes (chimpanzee)
Brite
Enzymes [BR:ptr01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     465604 (USP11)
Peptidases [BR:ptr01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   465604 (USP11)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
X
AA seq 800 aa AA seqDB search
MAVAPRLFGGLCFRFRDQNPEVAVEGRLPISHSCVGCRRERTAMATVAANPAAAAAAVAA
AAAVAEDREPQHKELPGLDSQWRQIENGESGRERPLRAGESWFLVEKHWYKQWEAYVQGG
DQDSSTFPGCINNATLFQDEINWRLKEGLVEGEGYVLLPAAAWHXLVSWYGLEHGQPPIE
RKVIELPNIQKVEVYPVELLLVRHNDLGKSHTVQFSHTDSIGLVLRTARERFLVEPQEDT
RLWAKNSEGSLDRLYDTHITVLDAALETGQLIIMETRKKDGTWPSAQLHVMNNNMSEEDE
DFKGQPGICGLTNLGNTCFMNSALQCLSNVPQLTEYFLNNCYLEELNFRNPLGMKGEIAE
AYADLVKQAWSGHHRSIVPHVFKNKVGHFASQFLGYQQHDSQELLSFLLDGLHEDLNRVK
KKEYVELCDAAGRPDQEVAQEAWQNHKRRNDSVIVDTFHGLFKSTLVCPDCGNVSVTFDP
FCYLSVPLPISHKRVLEVFFIPMDPRRKPEQHRLVVPKKGKISDLCVALSKHTGISPERM
MVADVFSHRFYKLYQLEEPLSSILDRDDIFVYEVSGRIEAIEGSREDIVVPVYLRERTPA
RDYNNSYYGLMLFGHPLLVSVPRYRFTWEGLYNVLIFRLSRYVTKPNSDDEDDGDEKEDD
EEDKDDVPGPSTGGSLRDPEPEQAGPSSGVTNRCPFLLDNCLGTSQWPPRRRRKQLFTLQ
TVNSNGTSDRTTSPEEVHAQPYIAIDWEPEMKKRYYDEVEAEGYVKHDCVGYVMKKAPVR
LQECIELFTTVETLEKENPW
NT seq 2403 nt NT seq  +upstreamnt  +downstreamnt
atggcagtagccccgcgactgtttggggggctctgcttccgtttccgggaccagaatccg
gaagtggctgttgaggggcgtcttccaatctcgcacagctgcgttggctgtagaagagaa
cggacggcgatggcgacggtcgcagcaaatccagctgctgctgcggcggctgtggcggcg
gcagcggcggtggctgaggatagagagccacagcacaaggagctgccaggcctggacagc
cagtggcgccagatagaaaacggcgagagtgggcgagaacgtccactgcgggccggcgaa
agctggttccttgtggagaagcactggtataagcagtgggaggcatacgtgcagggaggg
gaccaggactccagcaccttccctggctgcatcaacaatgccacactctttcaagatgag
ataaactggcgcctcaaggagggactggtggaaggcgagggatatgtgctgctcccagca
gctgcttggcatntcctggtcagctggtatggtctagagcatggccagccacccattgaa
cgcaaggtcatagagctgcccaacatccagaaggtcgaagtgtacccagtagaactgctg
cttgtccggcacaatgatttgggcaaatctcacactgttcagttcagccataccgattct
attggcctagtattgcgcacagctcgggagcggtttctggtggagccccaggaagacact
cggctttgggccaagaactcagaaggctctttggataggttgtatgacacacacatcacg
gttctcgatgcggcccttgagactgggcagttgatcatcatggagacccgcaagaaagat
ggcacttggcccagcgcacagctgcatgtcatgaacaacaacatgtcggaagaggatgag
gacttcaagggtcagccaggcatctgtggcctcaccaatctgggcaacacgtgcttcatg
aactcggccctgcagtgcctcagcaatgtgccacagctcaccgagtacttcctcaacaac
tgctacctggaggagctcaacttccgcaacccactgggcatgaagggtgagatcgcagag
gcctatgcagacctggtgaagcaggcgtggtctggccaccaccgctccattgtgccacat
gtgttcaagaacaaggttggccattttgcatcccaatttctgggctaccagcagcatgac
tctcaggagctgctgtcattcctcctggacgggctgcatgaggaccttaatcgggtgaag
aagaaggagtatgtggagctgtgcgatgctgctgggcgaccggatcaggaggtggcacag
gaggcatggcaaaaccacaaacggcggaacgattctgtgatcgtggacactttccacggc
ctcttcaagtccacgctggtgtgccccgattgtggcaatgtatctgtgaccttcgacccc
ttctgctacctcagtgttccactgcctatcagccacaagagggtcttggaggtcttcttt
atccccatggatccgcgccgcaagccagagcagcaccggctcgtggtccccaagaaaggc
aagatctcggatctatgtgtggctctgtccaaacacacgggcatctcgccagagaggatg
atggtggctgatgtcttcagtcaccgcttctataagctctatcagctagaggagcctctg
agtagcatcttggaccgtgatgatatcttcgtctatgaggtgtcaggtcgcattgaggcc
attgagggctcaagagaggacatcgtggttcctgtctacctgcgggagcgcacccctgcc
cgtgactacaacaactcctactacggcctgatgctttttggacaccccctcctggtatca
gtgccccgttaccgcttcacctgggagggcctgtataatgtcctgatcttccggctctca
cgctacgtgaccaaacccaactcagatgatgaggacgatggggatgagaaagaagatgac
gaggaggataaagacgacgtccctgggccctcaactgggggcagcctccgagaccctgag
ccagagcaggctgggcccagctctggagtcacgaacaggtgcccgttcctcctggacaat
tgccttggcacatctcagtggcccccaaggcgacgacgcaagcagctgttcaccctgcag
acggtgaactccaatgggaccagcgaccgcacaacctcccctgaagaagtccatgcccag
ccgtacattgctatcgactgggagccagagatgaagaagcgttactatgacgaggtagag
gctgagggctacgtgaagcatgactgcgtcgggtacgtgatgaagaaggctcccgtgcgg
ctgcaggagtgcattgagctcttcaccactgtggagaccctggagaaggaaaacccctgg
tga

DBGET integrated database retrieval system