KEGG   Pan troglodytes (chimpanzee): 465660Help
Entry
465660            CDS       T01005                                 

Gene name
USP51
Definition
ubiquitin specific peptidase 51
Orthology
K11366  
ubiquitin carboxyl-terminal hydrolase 22/27/51 [EC:3.1.2.15]
Organism
ptr  Pan troglodytes (chimpanzee)
Brite
Enzymes [BR:ptr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     465660 (USP51)
Peptidases [BR:ptr01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   465660 (USP51)
Transcription machinery [BR:ptr03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     465660 (USP51)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
X
AA seq 711 aa AA seqDB search
MAQVRETSLPSGSGVRWISGGGGGASPEEAVEKAGKMEEAVAGATKASSRREAEEMKLEP
LQEREPAPEENLTWSSSGGDEKVLPSIPLRCHTSSSPVCPRRKPRPRPQPRARSRSQPGL
SAPPPPPARPPPPPPPPPPPAPRPRAWRGSRRRSRPGSRPQTRRSCSGDLDGSGDPGGLG
DWLLEVEFGQGPTGCSHVESFKVGKNWQKNLRLIYQRFVWSGTPETRKRKAKSCICHVCS
THMNRLHSCLSCVFFGCFTEKHIHKHAETKQHHLAVDLYHGVIYCFMCKDYVYDKDIEQI
AKETKEKILRLLTSTSTDVSHQQFMTSGFEDKQSTCETKEQEPKLVKPKKKRRKKSVYTV
GLRGLINLGNTCFMNCIVQALTHIPLLKDFFLSDKHKCIMTSPSLCLVCEMSSLFHAMYS
GSRTPHIPYKLLHLIWIHAEHLAGYRQQDAHEFLIAILDVLHRHSKDDSGGQEANNPNCC
NCIIDQIFTGGLQSDVTCQACHSVSTTIDPCWDISLDLPGSCATFDSQNPERADSAVSRD
DHIPGIPSLTDCLQWFTRPEHLGSSAKIKCNSCQSYQESTKQLTMKKLPIVACFHLKRFE
HVGKQRRKINTFISFPLELDMTPFLASTKESRMKEGQPPTDCVPNENKYSLFAVINHHGT
LESGHYTSFIRQQKDQWFSCDDAIITKATIEDLLYSEGYLLFYHKQGLEKD
NT seq 2136 nt NT seq  +upstreamnt  +downstreamnt
atggcccaggttcgagaaacttctttgccctccggctctggggtccgctggatctccgga
ggtgggggaggagcctctcctgaggaggcggttgagaaggcggggaaaatggaggaggcg
gtggcgggggctacgaaggcgtcttcgagacgggaagctgaggagatgaagctggagcca
ttacaagagcgtgagcccgcgccggaggagaacttgacgtggagcagcagcggcggcgac
gagaaggtgctcccttcaatcccccttcgctgtcacaccagctcctcgcccgtttgcccg
cgccgcaagccccgccctcggccccagccccgggcccgctcccgcagccagcctgggctc
tcggccccacccccgcctccagcccggcccccgcccccgccgccacccccgcccccaccc
gcaccgcggcccagggcctggcgtggatcccggcgcagatcccggcctgggtccaggcct
cagacacggagaagctgctctggtgacctagacgggtcgggggatcctggcggcttaggg
gactggttgctggaggtcgagtttggtcagggtcccacaggctgctctcatgtggagagc
tttaaagtaggtaagaactggcagaagaacctgaggttgatctaccagcgtttcgtttgg
agtgggaccccagagactaggaaacgtaaagcaaagtcatgcatctgtcacgtatgtagt
acccatatgaacagactccactcttgtctctcctgtgtcttttttggctgcttcactgag
aaacatattcacaaacatgcagaaacaaagcagcaccatttagctgtagacctttatcat
ggggtcatatattgcttcatgtgtaaggattatgtatatgacaaagacatagaacagatt
gccaaagaaacaaaagaaaaaattttgagattattaacttccacctcaacagatgtttct
catcaacagtttatgacatcagggtttgaagacaagcaatcaacctgtgagacaaaggaa
caggagccaaaattggtgaaacccaagaaaaagagaagaaaaaagtcagtctatactgta
ggcctgagagggctaatcaatcttgggaacacttgttttatgaattgtattgtccaggca
cttacccatattcctctactgaaagatttcttcctctctgacaagcacaaatgtataatg
acaagccccagcttgtgtctggtctgtgaaatgtcttcgctttttcatgctatgtactct
gggagccgaactcctcacattccctataagttactgcatctgatatggatccatgcagaa
catttagcagggtacaggcagcaggatgcccatgagttccttattgcaatattagacgtg
ctacatagacacagcaaagatgatagtggtgggcaggaggccaataaccccaactgctgt
aactgcatcatagaccaaatctttacaggtggcctgcaatcagatgtcacatgtcaagcc
tgccatagtgtttctaccaccatagacccatgctgggacatcagtttggacttgcctggc
tcttgtgccacattcgattcccagaacccagagagggctgacagcgcagtgagcagggat
gaccacataccaggaatcccctcacttacagactgtctacagtggtttacaaggccagag
cacctaggaagcagtgccaaaatcaaatgcaatagttgccaaagctaccaggagtctact
aaacagctcacaatgaaaaaattacccattgtggcttgttttcatctcaagcggtttgag
catgtaggcaaacagaggcgaaagattaatacctttatctcctttcccttggagctggac
atgactccgtttttggcctctactaaagagagcagaatgaaagaaggccagccaccaaca
gattgtgtgcccaatgagaataagtattccttgtttgcagtgattaatcaccatggaact
ttggaaagtggccactataccagcttcatccggcaacaaaaggaccagtggttcagctgt
gatgatgccatcatcaccaaggctaccattgaggacttactctacagtgaagggtattta
ctgttctatcacaaacagggtctagagaaagactag

DBGET integrated database retrieval system