KEGG   Pan troglodytes (chimpanzee): 466014Help
Entry
466014            CDS       T01005                                 

Gene name
SUV39H2
Definition
suppressor of variegation 3-9 homolog 2 (Drosophila)
Orthology
K11419  
histone-lysine N-methyltransferase SUV39H [EC:2.1.1.43]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
Lysine degradation
Class
Metabolism; Amino acid metabolism; Lysine degradation [PATH:ptr00310]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
10
AA seq 170 aa AA seqDB search
MEYYLVKWKGWPDSTNTWEPLQNLKCPLLLQQFSNDKHNYLSQVITSEEAERRGQFYDNK
GITYLFDLDYESDEFTVDAARYGNVSHFVNHSCDPNLQVFNVFIDNLDTRLPRIALFSTR
TINAGEELTFDYQMKGSGDISSDSIDHSPAKKRVRTVCKCGAVTCRGYLN
NT seq 513 nt NT seq  +upstreamnt  +downstreamnt
atggaatattatcttgtaaaatggaaaggatggccagattctacaaatacttgggaacct
ttgcaaaatctgaagtgcccgttactgcttcagcaattctctaatgacaagcataattat
ttatctcaggtaatcacaagtgaagaagctgaaagacggggacagttctatgacaacaag
ggaatcacgtatctctttgatctggactatgaatctgatgaattcacagtggatgcggct
cgatacggcaatgtgtctcattttgtgaatcacagctgtgacccaaatcttcaggtgttc
aatgttttcatcgataacctcgatactcgtcttccccgaatagcattgttttccacaaga
accataaatgctggagaagagctgacttttgattatcaaatgaaaggttctggagatata
tcttcagattctattgaccacagcccagccaaaaagagggtcagaacagtatgtaaatgt
ggagctgtgacttgcagaggttacctcaactga

DBGET integrated database retrieval system