KEGG   Pan troglodytes (chimpanzee): 466147Help
Entry
466147            CDS       T01005                                 

Gene name
STAMBPL1
Definition
STAM binding protein-like 1 (EC:3.1.2.15)
Orthology
K11867  
AMSH-like protease [EC:3.1.2.15]
Organism
ptr  Pan troglodytes (chimpanzee)
Brite
Enzymes [BR:ptr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     466147 (STAMBPL1)
Peptidases [BR:ptr01002]
 Metallo Peptidases
  Family M67
   466147 (STAMBPL1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
10
AA seq 436 aa AA seqDB search
MDQPFTVNSLKKLAAMPDHTDVSLSPEERVRALSKLGCNITISEDITPRRYFRSGVEMER
MASVYLEEGNLENAFVLYNKFITLFVEKLPNHRDYQQCAVPEKQDIMKKLKEIAFPRTDE
LKNDLLKKYNVEYQEYLQSKNKYKAEILKKLEHQRLIEAERKRIAQMRQQQLESEQFLFF
EDQLKKQELARGQMRSQHTSGLSEQIDGSALSCFSTHQNNSLLNVFADQPNKSDATNYAS
HSPPVNRALTPAATLSAVRNLVVEGLRCVVLPEDLCHKFLQLAESNTVRGIETCGILCGK
LTHNEFTITHVIVPKQSAGPDYCDMENVEELFNVQDQHDLLTLGWIHTHPTQTAFLSSVD
LHTHCSYQLMLPEAIAIVCSPKHKDTGIFRLTNAGMLEVSACKKKGFHPHTKEPRLFSIC
KHVLVKDIKIIVLDLR
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
atggatcagccttttactgtgaattctctgaaaaagttagctgctatgcctgaccataca
gatgtttccctaagcccagaagagcgagtccgtgccctaagcaagcttggttgtaatatc
accatcagtgaagacatcactccacgacgttactttaggtctggagtagagatggagagg
atggcgtctgtgtatttggaagaaggaaatttggaaaatgcctttgttctttataataaa
tttataaccttatttgtagaaaagcttcctaaccatcgagattaccagcaatgtgcagta
cctgaaaagcaggatattatgaagaaactgaaggagattgcattcccaaggacagatgaa
ttgaaaaacgaccttttaaagaaatataacgtagaataccaagaatatttgcaaagcaaa
aacaaatataaagctgaaattctcaaaaaattggagcatcagagattgatagaggcagaa
aggaagcggattgctcagatgcgccagcagcagctagaatcggagcagtttctgtttttc
gaagatcaactcaagaagcaagagttagcccgaggtcaaatgcgaagtcagcatacctca
gggctgtcagagcagattgatgggagcgctttgtcctgcttttccacacaccagaacaat
tccttgctgaatgtatttgcagatcaacctaataaaagtgatgcaaccaattatgctagc
cactctcctcctgtaaacagggccttaacgccagctgctactctaagtgctgttcggaat
ttagtggttgaaggactgcgatgtgtagttttgccagaagatctttgccacaaatttctg
caactggcagaatctaatacagtgagaggaatagaaacctgtggaatactctgtggaaaa
ctgacacataatgaatttactattacccatgtaattgtgccaaagcagtctgcgggacca
gactattgtgacatggagaatgtagaggaattattcaatgttcaggatcaacatgatctc
ctcactctaggatggatccatacgcatcccactcaaactgcatttttatccagcgttgat
cttcacactcactgttcctatcaactcatgttgccagaggccattgccattgtttgctca
ccaaagcataaagacactggcatcttcaggctcaccaatgctggcatgcttgaggtttct
gcttgtaaaaaaaagggctttcatccacacaccaaggagcccaggctgttcagtatatgc
aaacatgtgttggtaaaagacataaaaataattgtgttggatctgaggtga

DBGET integrated database retrieval system