KEGG   Pan troglodytes (chimpanzee): 466768Help
Entry
466768            CDS       T01005                                 

Gene name
GRIA4
Definition
glutamate receptor, ionotropic, AMPA 4
Orthology
K05200  
glutamate receptor 4
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
Neuroactive ligand-receptor interaction
Circadian entrainment
Retrograde endocannabinoid signaling
Glutamatergic synapse
Dopaminergic synapse
Amphetamine addiction
Nicotine addiction
Class
Environmental Information Processing; Signaling molecules and interaction; Neuroactive ligand-receptor interaction [PATH:ptr04080]
Organismal Systems; Nervous system; Glutamatergic synapse [PATH:ptr04724]
Organismal Systems; Nervous system; Dopaminergic synapse [PATH:ptr04728]
Organismal Systems; Nervous system; Retrograde endocannabinoid signaling [PATH:ptr04723]
Organismal Systems; Environmental adaptation; Circadian entrainment [PATH:ptr04713]
Human Diseases; Substance dependence; Amphetamine addiction [PATH:ptr05031]
Human Diseases; Substance dependence; Nicotine addiction [PATH:ptr05033]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
11
AA seq 867 aa AA seqDB search
MGAFXSSVQIGGLFIRNTDQEYTAFRLAIFLHNTSPNASEAPFNLVPHVDNIETANSFAV
TNAFCSQYSRGVFAIFGLYDKRSVHTLTSFCSALHISLITPSFPTEGESQFVLQLRPSLR
GALLSLLDHYEWNCFVFLYDTDRGYSILQAIMEKAGQNGWHVSAICVENFNDVSYRQLLE
ELDRRQEKKFVIDCEIERLQNILEQIVSVGKHVKGYHYIIANLGFKDISLERFIHGGANV
TGFQLVDFNTPMVIKLMDRWKKLDQREYPGSETPPKYTSALTYDGVLVMAETFRSLRRQK
IDISRRGNAGDCLANPAAPWGQGIDMERTLKQVRIQGLTEFLQGDSLNYGRRVNYTMDVF
ELKSTAKRKVGYWNDMDKLVLIQDVPTLGNDTAAIENRTVVVTTIMESPYVMYKKNHEMF
EGNDKYEGYCVDLASEIAKHIGIKYKIAIVPDGKYGARDADTKIWNGMVGELVYGKAEIA
IAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLDPLAYEIWMCIVFAYIG
VSVVLFLVSRFSPYEWHTEEPEDGKEGPSDQPPNEFGIFNSLWFSLGAFMQQGCDISPRS
LSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLAKQTEIAYGTLDSGST
KEFFRRSKIAVYEKMWTYMRSAEPSVFTRTTAEGVARVRKSKGKFAFLLESTMNEYIEQR
KPCDTMKVGGNLDSKGYGVATPKGSSLRNAVNLAVLKLNEQGLLDKLKNKWWYDKGECGS
GGGDSKDKTSALSLSNVAGVFYILVGGLGLAMLVALIEFCYKSRAEAKRMKVAKSAQTFN
PTSSQNTQNLATYREGYNVYGTESIKI
NT seq 2604 nt NT seq  +upstreamnt  +downstreamnt
atgggagcctttncgagcagcgtgcaaataggtggtctcttcatccgaaacacagatcag
gaatacactgcttttcgattagcaatttttcttcataacaccagccccaatgcgtcggaa
gctccttttaatttggtacctcatgtggacaacattgagacagccaacagttttgctgta
acaaacgccttctgttcccagtattctagaggagtatttgccatttttggactctatgat
aagaggtcggtacataccttgacctcattctgcagcgccttacatatctccctcatcaca
ccaagtttccctactgagggggagagccagtttgtgctgcaactaagaccttcgttacga
ggagcactcttgagtttgctggatcactacgaatggaactgttttgtcttcctgtatgac
acagacaggggatactcgatactccaagctattatggaaaaagcaggacaaaatggttgg
catgtcagcgctatatgtgtggaaaattttaatgatgtcagctataggcaacttctagaa
gaacttgatagaagacaagagaagaagtttgtaatagactgtgagatagagagacttcaa
aacatattagaacagattgtaagtgttggaaagcatgttaaaggctaccattatatcatt
gcaaacttgggattcaaggatatttctcttgagaggtttatacatggtggagccaatgtt
actggattccagttggtggattttaatacacctatggtaatcaaactaatggatcgctgg
aagaaactagatcagagagagtatccaggatctgagactcctccaaagtacacctctgct
ctgacttatgatggagtccttgtgatggctgaaactttccgaagtcttaggaggcagaaa
attgatatctcaaggagaggaaatgctggggattgtctggcaaatcctgctgctccatgg
ggccagggaattgacatggagaggacactcaaacaggttcgaattcaagggctgacagaa
ttcctacagggggatagtttgaactatggacgtagagtcaattacacaatggatgtgttt
gagctgaaaagcacagctaaaaggaaggttggttactggaatgatatggataagttagtc
ttgattcaagatgtaccaactcttggcaatgacacagctgctattgagaacagaacagtg
gttgtaaccacaattatggaatccccatatgttatgtacaagaaaaatcatgaaatgttt
gaaggaaatgacaagtatgaaggatactgtgtagatttggcatctgaaattgcaaaacac
attggtatcaagtataaaattgccattgtccctgatggaaaatatggagcaagggatgca
gacacaaaaatctggaatgggatggtaggagaacttgtttatgggaaagcagagattgct
attgcccctctgacaatcactttggtacgagaggaggtcattgacttttctaagcccttc
atgagtttgggcatatctatcatgatcaaaaagcctcagaaatccaaaccaggagtgttt
tccttcttggatcctctggcctatgagatttggatgtgcatagtctttgcctacattggt
gtcagcgtggtcttattcctagttagtagatttagtccatatgagtggcatacagaagag
ccagaggatggaaaggaaggacccagcgaccagcctcccaatgagtttggcatctttaac
agcctctggttttccctgggtgcttttatgcagcaaggatgtgacatttcacccagatcc
ctctcaggtcgaattgttggaggtgtttggtggttctttacactcatcattatatcatct
tatactgctaacctcgctgctttcctgacggttgagcgaatggtctctcccatagaaagt
gcagaagacctagccaaacaaacagaaattgcctatggaacattggattcagggtcaaca
aaagaattcttcagaagatcaaaaatagcagtgtatgaaaagatgtggacctacatgcga
tcagcagagccatcagtgttcactaggactacagctgagggagtagctcgtgtccgcaaa
tccaagggcaaatttgcctttctcctggagtccactatgaatgaatacattgagcagcga
aagccatgtgacacgatgaaagtgggaggaaatctggattccaaaggctatggagtagca
acgcccaagggttcctcattaagaaatgctgttaacctcgcagttttaaaactgaatgaa
caaggcctcttggacaaattgaaaaacaaatggtggtacgacaaaggagaatgtggcagc
gggggaggtgactccaaggacaagacgagtgccttgagcctgagcaatgtagcaggcgtc
ttctacattctggttggcggcttgggcttggcaatgctggtggctttgatagagttctgt
tacaagtccagggcagaagcgaagagaatgaaggtggcaaagagtgcacagacttttaac
ccaacttcctcgcagaatacccagaatttagcaacctatagagaaggttacaacgtatat
ggaaccgaaagtattaaaatttag

DBGET integrated database retrieval system