KEGG   Pan troglodytes (chimpanzee): 466768Help
Entry
466768            CDS       T01005                                 

Gene name
GRIA4
Definition
glutamate receptor, ionotropic, AMPA 4
Orthology
K05200  
glutamate receptor 4
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
cAMP signaling pathway
Neuroactive ligand-receptor interaction
Circadian entrainment
Retrograde endocannabinoid signaling
Glutamatergic synapse
Dopaminergic synapse
Amphetamine addiction
Nicotine addiction
Brite
KEGG Orthology (KO) [BR:ptr00001]
 Environmental Information Processing
  Signal transduction
   04024 cAMP signaling pathway
    466768 (GRIA4)
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    466768 (GRIA4)
 Organismal Systems
  Nervous system
   04724 Glutamatergic synapse
    466768 (GRIA4)
   04728 Dopaminergic synapse
    466768 (GRIA4)
   04723 Retrograde endocannabinoid signaling
    466768 (GRIA4)
  Environmental adaptation
   04713 Circadian entrainment
    466768 (GRIA4)
 Human Diseases
  Substance dependence
   05031 Amphetamine addiction
    466768 (GRIA4)
   05033 Nicotine addiction
    466768 (GRIA4)
Ion channels [BR:ptr04040]
 Glutamate-gated cation channels
  Glutamate (ionotropic), non-NMDA
   466768 (GRIA4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
11
AA seq 886 aa AA seqDB search
MRIICRQIVLLFSGFWGLAMGAFXSSVQIGGLFIRNTDQEYTAFRLAIFLHNTSPNASEA
PFNLVPHVDNIETANSFAVTNAFCSQYSRGVFAIFGLYDKRSVHTLTSFCSALHISLITP
SFPTEGESQFVLQLRPSLRGALLSLLDHYEWNCFVFLYDTDRGYSILQAIMEKAGQNGWH
VSAICVENFNDVSYRQLLEELDRRQEKKFVIDCEIERLQNILEQIVSVGKHVKGYHYIIA
NLGFKDISLERFIHGGANVTGFQLVDFNTPMVIKLMDRWKKLDQREYPGSETPPKYTSAL
TYDGVLVMAETFRSLRRQKIDISRRGNAGDCLANPAAPWGQGIDMERTLKQVRIQGLTEF
LQGDSLNYGRRVNYTMDVFELKSTAKRKVGYWNDMDKLVLIQDVPTLGNDTAAIENRTVV
VTTIMESPYVMYKKNHEMFEGNDKYEGYCVDLASEIAKHIGIKYKIAIVPDGKYGARDAD
TKIWNGMVGELVYGKAEIAIAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFS
FLDPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYEWHTEEPEDGKEGPSDQPPNEFGIFNS
LWFSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESA
EDLAKQTEIAYGTLDSGSTKEFFRRSKIAVYEKMWTYMRSAEPSVFTRTTAEGVARVRKS
KGKFAFLLESTMNEYIEQRKPCDTMKVGGNLDSKGYGVATPKGSSLRNAVNLAVLKLNEQ
GLLDKLKNKWWYDKGECGSGGGDSKDKTSALSLSNVAGVFYILVGGLGLAMLVALIEFCY
KSRAEAKRMKVAKSAQTFNPTSSQNTQNLATYREGYNVYGTESIKI
NT seq 2661 nt NT seq  +upstreamnt  +downstreamnt
atgaggattatttgcagacagattgtcttgttattttctggattttggggactcgccatg
ggagcctttncgagcagcgtgcaaataggtggtctcttcatccgaaacacagatcaggaa
tacactgcttttcgattagcaatttttcttcataacaccagccccaatgcgtcggaagct
ccttttaatttggtacctcatgtggacaacattgagacagccaacagttttgctgtaaca
aacgccttctgttcccagtattctagaggagtatttgccatttttggactctatgataag
aggtcggtacataccttgacctcattctgcagcgccttacatatctccctcatcacacca
agtttccctactgagggggagagccagtttgtgctgcaactaagaccttcgttacgagga
gcactcttgagtttgctggatcactacgaatggaactgttttgtcttcctgtatgacaca
gacaggggatactcgatactccaagctattatggaaaaagcaggacaaaatggttggcat
gtcagcgctatatgtgtggaaaattttaatgatgtcagctataggcaacttctagaagaa
cttgatagaagacaagagaagaagtttgtaatagactgtgagatagagagacttcaaaac
atattagaacagattgtaagtgttggaaagcatgttaaaggctaccattatatcattgca
aacttgggattcaaggatatttctcttgagaggtttatacatggtggagccaatgttact
ggattccagttggtggattttaatacacctatggtaatcaaactaatggatcgctggaag
aaactagatcagagagagtatccaggatctgagactcctccaaagtacacctctgctctg
acttatgatggagtccttgtgatggctgaaactttccgaagtcttaggaggcagaaaatt
gatatctcaaggagaggaaatgctggggattgtctggcaaatcctgctgctccatggggc
cagggaattgacatggagaggacactcaaacaggttcgaattcaagggctgacagaattc
ctacagggggatagtttgaactatggacgtagagtcaattacacaatggatgtgtttgag
ctgaaaagcacagctaaaaggaaggttggttactggaatgatatggataagttagtcttg
attcaagatgtaccaactcttggcaatgacacagctgctattgagaacagaacagtggtt
gtaaccacaattatggaatccccatatgttatgtacaagaaaaatcatgaaatgtttgaa
ggaaatgacaagtatgaaggatactgtgtagatttggcatctgaaattgcaaaacacatt
ggtatcaagtataaaattgccattgtccctgatggaaaatatggagcaagggatgcagac
acaaaaatctggaatgggatggtaggagaacttgtttatgggaaagcagagattgctatt
gcccctctgacaatcactttggtacgagaggaggtcattgacttttctaagcccttcatg
agtttgggcatatctatcatgatcaaaaagcctcagaaatccaaaccaggagtgttttcc
ttcttggatcctctggcctatgagatttggatgtgcatagtctttgcctacattggtgtc
agcgtggtcttattcctagttagtagatttagtccatatgagtggcatacagaagagcca
gaggatggaaaggaaggacccagcgaccagcctcccaatgagtttggcatctttaacagc
ctctggttttccctgggtgcttttatgcagcaaggatgtgacatttcacccagatccctc
tcaggtcgaattgttggaggtgtttggtggttctttacactcatcattatatcatcttat
actgctaacctcgctgctttcctgacggttgagcgaatggtctctcccatagaaagtgca
gaagacctagccaaacaaacagaaattgcctatggaacattggattcagggtcaacaaaa
gaattcttcagaagatcaaaaatagcagtgtatgaaaagatgtggacctacatgcgatca
gcagagccatcagtgttcactaggactacagctgagggagtagctcgtgtccgcaaatcc
aagggcaaatttgcctttctcctggagtccactatgaatgaatacattgagcagcgaaag
ccatgtgacacgatgaaagtgggaggaaatctggattccaaaggctatggagtagcaacg
cccaagggttcctcattaagaaatgctgttaacctcgcagttttaaaactgaatgaacaa
ggcctcttggacaaattgaaaaacaaatggtggtacgacaaaggagaatgtggcagcggg
ggaggtgactccaaggacaagacgagtgccttgagcctgagcaatgtagcaggcgtcttc
tacattctggttggcggcttgggcttggcaatgctggtggctttgatagagttctgttac
aagtccagggcagaagcgaagagaatgaaggtggcaaagagtgcacagacttttaaccca
acttcctcgcagaatacccagaatttagcaacctatagagaaggttacaacgtatatgga
accgaaagtattaaaatttag

DBGET integrated database retrieval system