KEGG   Pan troglodytes (chimpanzee): 466792Help
Entry
466792            CDS       T01005                                 

Gene name
APOA4
Definition
apolipoprotein A-IV
Orthology
K08760  
apolipoprotein A-IV
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
Fat digestion and absorption
Vitamin digestion and absorption
Brite
KEGG Orthology (KO) [BR:ptr00001]
 Organismal Systems
  Digestive system
   04975 Fat digestion and absorption
    466792 (APOA4)
   04977 Vitamin digestion and absorption
    466792 (APOA4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
11
AA seq 396 aa AA seqDB search
MFLKAVVLTLALVAVTGARAEVSADQVATVMWDYFSQLSNNAKEAVEHLQKSELTQQLNA
LFQDKLGEVNTYAGDLQKKLVPFATELHERLAKDSEKLKEEIRKELEELRARLLPHANEV
SQKIGDNVLELQQRLEPYADQLRTQVNTQAEQLRRQLTPYAERMERVLRENADSLQASLR
PHADELKAKIDQNVEELKGRLTPYADEFKVKIDQTVEELRRSLAPYAQDTQEKLNHQLEG
LAFQMKKNAEELKARISASAEELRQRLAPLAEDVRGNLRGNTEGLQKSLAELGGHLDQQV
EEFRRRVEPYGENFNKALVQQMEQLRQKLGPHAGDVEGHLSFLEKDLRDKVNSFFSTFKE
KESQDKTLSLPELEQQQEQQQEQQQEQVQMLAPLES
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgttcctgaaggccgtggtcctgaccctggccctggtggctgtcaccggagccagggct
gaggtcagtgctgaccaggtggccacggtgatgtgggactacttcagccagctgagcaac
aatgccaaggaggccgtggaacatctccagaaatctgaactcacccagcaactcaatgcc
ctcttccaggacaaacttggagaagtgaacacttacgcaggtgacctgcagaagaagctg
gtgccctttgccaccgagctgcatgaacgcctggccaaggactcggagaaactgaaggag
gagattcggaaggagctggaggagctgagggcccggctgctgccccatgccaatgaggtg
agccagaagatcggggacaacgtgctagagcttcagcagcgcctggagccctacgcggac
cagctgcgcacccaggtcaacacgcaggccgagcagctgcggcgccagctgaccccctac
gcagagcgcatggagagagtgctgcgggagaacgccgacagcctgcaggcctcgctgagg
ccccacgccgacgagctcaaggccaagatcgaccagaacgtggaggagctcaagggacgc
cttacgccctacgccgacgaattcaaagtcaagattgaccagaccgtggaggagctgcgc
cgcagcctggctccctatgctcaggacacgcaggagaagctcaaccaccagcttgagggc
ctggccttccagatgaagaagaacgccgaggagctcaaggccaggatctcggccagtgcc
gaggagctgcggcagaggctggcgcccttggccgaggacgtgcgtggcaacctgaggggc
aacaccgaggggctgcagaagtcactggcagagctgggtgggcacctggaccagcaggtg
gaggagttccgacgccgggtggagccctacggggaaaacttcaacaaagccctggtgcag
cagatggaacagctcaggcagaagctgggcccccatgcgggggacgtggaaggccacttg
agcttcctggagaaggacctgagggacaaggtcaactccttcttcagcaccttcaaggag
aaagagagccaggacaagaccctctccctccccgagctggagcaacagcaggaacagcag
caggagcagcagcaggagcaggtgcagatgctggcccctttggagagctga

DBGET integrated database retrieval system