KEGG   Pan troglodytes (chimpanzee): 467662Help
Entry
467662            CDS       T01005                                 

Gene name
CHP1
Definition
(RefSeq) calcineurin B homologous protein 1
  KO
K17610  calcineurin B homologous protein 1
Organism
ptr  Pan troglodytes (chimpanzee)
Brite
Protein phosphatases and associated proteins [BR:ptr01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     467662 (CHP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_8 EF-hand_5 SPARC_Ca_bdg RST
Motif
Other DBs
NCBI-GeneID: 467662
NCBI-ProteinID: XP_523056
Ensembl: ENSPTRG00000006942
UniProt: H2Q976
Position
15
AA seq 195 aa AA seqDB search
MGSRASTLLRDEELEEIKKETGFSHSQITRLYSRFTSLDKGENGTLSREDFQRIPELAIN
PLGDRIINAFFPEGEDQVNFRGFMRTLAHFRPIEDNEKSKDVNGPEPLNSRSNKLHFAFR
LYDLDKDEKISRDELLQVLRMMVGVNISDEQLGSIADRTIQEADQDGDSAISFTEFVKVL
EKVDVEQKMSIRFLH
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atgggttctcgggcctccacgttactgcgggacgaagagctcgaggagatcaagaaggag
accggcttttcccacagtcaaatcactcgcctctacagccggttcaccagcctggacaaa
ggagagaatgggactctcagccgggaagatttccagaggattccagaacttgccatcaac
ccactgggggaccggatcattaatgccttctttccagagggagaggaccaggtaaacttc
cgtggattcatgcgaactttggctcatttccgccccattgaggataatgaaaagagcaaa
gatgtgaatggacccgaaccactcaacagccgaagcaacaaactgcactttgcttttcga
ctatatgatttggataaagatgaaaagatctcccgtgatgagctgttacaggtgctacgc
atgatggtcggagtaaatatctcagatgagcagctgggcagcatcgcagacaggaccatt
caggaggctgatcaggatggggacagtgccatatctttcacagaatttgttaaggttttg
gagaaggtggatgtagaacagaaaatgagcatccgatttcttcactaa

DBGET integrated database retrieval system