KEGG   Pan troglodytes (chimpanzee): 467891Help
Entry
467891            CDS       T01005                                 

Gene name
CREBBP
Definition
CREB binding protein
Orthology
K04498  
E1A/CREB-binding protein [EC:2.3.1.48]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
cAMP signaling pathway
HIF-1 signaling pathway
FoxO signaling pathway
Cell cycle
Wnt signaling pathway
Notch signaling pathway
TGF-beta signaling pathway
Adherens junction
Jak-STAT signaling pathway
Long-term potentiation
Melanogenesis
Thyroid hormone signaling pathway
Huntington's disease
Tuberculosis
Hepatitis B
Influenza A
HTLV-I infection
Herpes simplex infection
Epstein-Barr virus infection
Pathways in cancer
Viral carcinogenesis
MicroRNAs in cancer
Renal cell carcinoma
Prostate cancer
Brite
KEGG Orthology (KO) [BR:ptr00001]
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    467891 (CREBBP)
   04330 Notch signaling pathway
    467891 (CREBBP)
   04350 TGF-beta signaling pathway
    467891 (CREBBP)
   04630 Jak-STAT signaling pathway
    467891 (CREBBP)
   04066 HIF-1 signaling pathway
    467891 (CREBBP)
   04068 FoxO signaling pathway
    467891 (CREBBP)
   04024 cAMP signaling pathway
    467891 (CREBBP)
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    467891 (CREBBP)
  Cell communication
   04520 Adherens junction
    467891 (CREBBP)
 Organismal Systems
  Endocrine system
   04919 Thyroid hormone signaling pathway
    467891 (CREBBP)
   04916 Melanogenesis
    467891 (CREBBP)
  Nervous system
   04720 Long-term potentiation
    467891 (CREBBP)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    467891 (CREBBP)
   05206 MicroRNAs in cancer
    467891 (CREBBP)
   05203 Viral carcinogenesis
    467891 (CREBBP)
   05211 Renal cell carcinoma
    467891 (CREBBP)
   05215 Prostate cancer
    467891 (CREBBP)
  Neurodegenerative diseases
   05016 Huntington's disease
    467891 (CREBBP)
  Infectious diseases
   05152 Tuberculosis
    467891 (CREBBP)
   05166 HTLV-I infection
    467891 (CREBBP)
   05164 Influenza A
    467891 (CREBBP)
   05161 Hepatitis B
    467891 (CREBBP)
   05168 Herpes simplex infection
    467891 (CREBBP)
   05169 Epstein-Barr virus infection
    467891 (CREBBP)
Enzymes [BR:ptr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     467891 (CREBBP)
Transcription factors [BR:ptr03000]
 Eukaryotic Type
  Other transcription factors
   Pocket domain CBP
    467891 (CREBBP)
Mitochondrial biogenesis [BR:ptr03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Coactivators
    467891 (CREBBP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
16
AA seq 2404 aa AA seqDB search
MAENLLDGPPNPKRAKLSSPGFSANDSTDFGSLFDLENDLPDELIPNGGELGLLNSGNLV
PDAASKHKQLSELLRGGSGSSINPGIGNVSASSPVQQGLGGQAQGQPNSANMASLSAMGK
SPLSQGDSSAPSLPKQAASTSGPTPPASQALNPQAQKQVGLATSSPATSQTGPGICMNAN
FNQTHPGLLNSNSGHSLINQASQGQAQVMNGSLGAAGRGRGAGMPYPTPAMQGASSSVLA
ETLTQVSPQMTGHAGLNTAQAGGMAKMGITGNTSPFGQPFSQAGGQPMGATGVNPQLASK
QSMVNSLPTFPTDIKNTSVTNVPNMSQMQTSVGIVPTQAIATGPTADPEKRKLIQQQLVL
LLHAHKCQRREQANGEVRACSLPHCRTMKNVLNHMTHCQAGKACQAILGSPASGIQNTIG
SVGTGQQNATSLSNPNPIDPSSMQRAYAALGLPYMNQPQTQLQPQVPGQQPAQPQTHQQM
RTLNPLGNNPMNIPAGGITTDQQPPNLISESALPTSLGATNPLMNDGSNSGNIGTLSTIP
TAAPPSSTGVRKGWHEHVTQDLRSHLVHKLVQAIFPTPDPAALKDRRMENLVAYAKKVEG
DMYESANSRDEYYHLLAEKIYKIQKELEEKRRSRLHKQGILGNQPALPAPGAQPPVIPQA
QPVRPPNGPLSLPVNRMQVSQGMNSFNPMSLGNVQLPQAPMGPRAASPMNHSVQMNSMGS
VPGMAISPSRMPQPPNMMGAHTNNMMAQAPAQSQFLPQNQFPSSSGAMSVGMGQPPAQTG
VSQGQVPGAALPNPLNMLGPQASQLPCPPVTQSPLHPTPPPASTAAGMPSLQHTTPPGMT
PPQPAAPTQPSTPVSSSGQTPTPTPGSVPSATQTQSTPTVQAAAQAQVTPQPQTPVQPPS
VATPQSSQQQPTPVHAQPPGTPLSQAAASIDNRVPTPSSVASAETNSQQPGPDVPVLEMK
TETQAEDTEPDPGESKGEPRSEMMEEDLQGASQVKEETDIAEQKSEPMEVDEKKPEVKVE
VKEEEESSSNGTASQSTSPSQPRKKIFKPEELRQALMPTLEALYRQDPESLPFRQPVDPQ
LLGIPDYFDIVKNPMDLSTIKRKLDTGQYQEPWQYVDDVWLMFNNAWLYNRKTSRVYKFC
SKLAEVFEQEIDPVMQSLGYCCGRKYEFSPQTLCCYGKQLCTIPRDAAYYSYQNRYHFCE
KCFTEIQGENVTLGDDPSQPQTTISKDQFEKKKNDTLDPEPFVDCKECGRKMHQICVLHY
DIIWPSGFVCDNCLKKTGRPRKENKFSAKRLQTTRLGNHLEDRVNKFLRRQNHPEAGEVF
VRVVASSDKTVEVKPGMKSRFVDSGEMSESFPYRTKALFAFEEIDGVDVCFFGMHVQEYG
SDCPPPNTRRVYISYLDSIHFFRPRCLRTAVYHEILIGYLEYVKKLGYVTGHIWACPPSE
GDDYIFHCHPPDQKIPKPKRLQEWYKKMLDKAFAERIIHDYKDIFKQATEDRLTSAKELP
YFEGDFWPNVLEESIKELEQEEEERKKEESTAASETTEGSQGDSKNAKKKNNKKTNKNKS
SISRANKKKPSMPNVSNDLSQKLYATMEKHKEVFFVIHLHAGPVINTLPPIVDPDPLLSC
DLMDGRDAFLTLARDKHWEFSSLRRSKWSTLCMLVELHTQGQDRFVYTCNECKHHVETRW
HCTVCEDYDLCINCYNTKSHAHKMVKWGLGLDDEGSSQGEPQSKSPQESRRLSIQRCIQS
LVHACQCRNANCSLPSCQKMKRVVQHTKGCKRKTNGGCPVCKQLIALCCYHAKHCQENKC
PVPFCLNIKHKLRQQQIQHRLQQAQLMRRRMATMNTRNVPQQSLPSPTSAPPGTPTQQPS
TPQTPQPPAQPQPSPVSMSPAGFPSVARTQPPTTVSTGKPTSQVPAPPPPAQPPPAAVEA
ARQIEREAQQQQHLYRVNINNSMPPGRTGMGTPGSQMAPVSLNVPRPNQVSGPVMPSMPP
GQWQQAPLPQQQPMPGLPRPVISMQAQAAVAGPRMPSVQPPRSISPSALQDLLRTLKSPS
SPQQQQQVLNILKSNPQLMAAFIKQRTAKYVANQPGMQPQPGLQSQPGMQPQPGMHQQPS
LQNLNAMQAGVPRPGVPPQQQAMGGLNPQGQALNIMNPGHNPNMASMNPQYREMLRRQLL
QQQQQQQQQQQQQQQQQQGSAGMAGGMAGHGQFQQPQGPGGYPPAMQQQQRMQQHLPLQG
SSMGQMAAQMGQLGQMGQPGLGADSTPNIQQALQQRILQQQQMKQQIGSPGQPNPMSPQQ
HMLSGQPQASHLPGQQIATSLSNQVRSPAPVQSPRPQSQPPHSSPSPRIQPQPSPHHVSP
QTGSPHPGLAVTMASSIDQGHLGNPEQSAMLPQLNTPSRSALSSELSLVGDTTGDTLEKF
VEGL
NT seq 7215 nt NT seq  +upstreamnt  +downstreamnt
atggctgagaacttgctggacggaccgcccaaccccaaaagagccaaactcagctcgccc
ggtttctcggcgaatgacagcacagattttggatcattgtttgacttggaaaatgatctt
cctgatgagctgatacccaatggaggagaattaggccttttaaacagtgggaaccttgtt
ccagatgctgcttccaaacataaacaactgtcggagcttctacgaggaggcagcggctct
agtatcaacccaggaataggaaatgtgagcgccagcagccccgtgcagcagggcctgggt
ggccaggctcaagggcagccgaacagtgcgaacatggccagcctcagtgccatgggcaag
agccctctgagccagggagattcttcagcccccagcctgcctaaacaggcagccagcacc
tctgggcccaccccccctgcctcccaagcactgaatccgcaagcacaaaagcaagtgggg
ctggcgactagcagccctgccacgtcacagactggacctggtatctgcatgaatgctaac
tttaaccagacccacccaggcctcctcaatagtaactctggccatagcttaattaatcag
gcttcacaagggcaggcgcaagtcatgaatggatctcttggggctgctggcagaggaagg
ggagctggaatgccgtaccctactccagccatgcagggcgcctcgagcagcgtgctggct
gagaccctaacgcaggtttccccgcaaatgactggtcacgcgggactgaacaccgcacag
gcaggaggcatggccaagatgggaataactgggaacacaagtccatttggacagcccttt
agtcaagctggagggcagccaatgggagccactggagtgaacccccagttagccagcaaa
cagagcatggtcaacagtttgcccaccttccctacagacatcaagaatacttcagtcacc
aacgtgccaaatatgtctcagatgcaaacatcagtgggaattgtacccacacaagcaatt
gcaacaggccccactgcagatcctgaaaaacgcaaactgatacagcagcagctggttcta
ctgcttcatgctcataagtgtcagagacgagagcaagcaaacggagaggttcgggcctgc
tcgctcccgcattgtcgaaccatgaaaaacgttttgaatcacatgacgcattgtcaggct
gggaaagcctgccaagccatcctggggtctccagctagtggaattcaaaacacaattggt
tctgttggcacagggcaacagaatgccacttctttaagtaacccaaatcccatagacccc
agctccatgcagcgagcctatgctgctctcggactcccctacatgaaccagccccagacg
cagctgcagcctcaggttcctggccagcaaccagcacagcctcaaacccaccagcagatg
aggactctcaaccccctgggaaataatccaatgaacattccagcaggaggaataacaaca
gatcagcagcccccaaacttgatttcagaatcagctcttccgacttccctgggggccaca
aacccactgatgaacgatggctccaactctggtaacattggaaccctcagcactatacca
acagcagctcctccttctagcaccggtgtaaggaaaggctggcacgaacatgtcactcag
gacctgcggagccatctagtgcataaactcgtccaagccatcttcccaacacctgatccc
gcagctctaaaggatcgccgcatggaaaacctggtagcctatgctaagaaagtggaaggg
gacatgtacgagtctgccaacagcagggatgaatattatcacttattagcagagaaaatc
tacaagatacaaaaagaactagaagaaaaacggaggtcgcgtttacataaacaaggcatc
ttggggaaccagccagccttaccagccccgggggctcagccccctgtgattccacaggca
caacctgtgagacctccaaatggacccctgtccctgccagtgaatcgcatgcaagtttct
caagggatgaattcatttaaccccatgtccttggggaatgtccagttgccacaagcaccc
atgggacctcgtgcagcctccccaatgaaccactctgtccagatgaacagcatgggctca
gtgccagggatggccatttctccttcccgaatgcctcagcctccgaacatgatgggtgca
cacaccaacaacatgatggcccaggcgcccgctcagagccagtttctgccacagaaccag
ttcccgtcatccagcggggcgatgagtgtgggcatggggcagccgccagcccaaacaggc
gtgtcacagggacaggtgcctggtgctgctcttcctaaccctctcaacatgctggggcct
caggccagccagctaccttgccctccagtgacacagtcaccactgcacccaacaccgcct
cctgcttccacggctgctggcatgccatctctccagcacacgacaccacctgggatgact
cctccccagccagcagctcccactcagccatcaactcctgtgtcgtcttccgggcagact
cccaccccgactcctggctcagtgcccagtgctacccaaacccagagcacccctacagtc
caggcagcagcccaggcccaggtgaccccgcagcctcaaaccccagttcagcccccgtct
gtggctacccctcagtcatcgcagcaacagccgacgcctgtgcacgcccagcctcctggc
acaccgctttcccaggcagcagccagcattgataacagagtccctaccccctcctcggtg
gccagcgcagaaaccaattcccagcagccaggacctgacgtacctgtgctggaaatgaag
acggagacccaagcagaggacactgagcccgatcctggtgaatccaaaggggagcccagg
tctgagatgatggaggaggatttgcaaggagcttcccaagttaaagaagaaacagacata
gcagagcagaaatcagaaccaatggaagtggatgaaaagaaacctgaagtgaaagtagaa
gttaaagaggaagaagagagtagcagtaacggcacagcctctcagtcaacatctccttca
cagccacgcaaaaaaatctttaaaccagaggagttacgccaggccctcatgccaacccta
gaagcactgtatcgacaggacccagagtcattacctttccggcagcctgtagatccccag
ctcctcggaattccagactattttgacatcgtaaagaatcccatggacctctccaccatc
aagcggaagctggacacagggcaataccaagagccctggcagtacgtggacgacgtctgg
ctcatgttcaacaatgcctggctctataatcgcaagacatcccgagtctataagttttgc
agtaagcttgcagaggtctttgagcaggaaattgaccctgtcatgcagtcccttggatat
tgctgtggacgcaagtatgagttttccccacagactttgtgctgctatgggaagcagctg
tgtaccattcctcgcgatgctgcctactacagctatcagaataggtatcatttctgtgag
aagtgtttcacagagatccagggcgagaatgtgaccctgggtgacgacccttcacagccc
cagacgacaatttcaaaggatcagtttgaaaagaagaaaaatgacaccttagaccccgaa
cctttcgttgattgcaaggagtgtggccggaagatgcatcagatttgcgttctgcactat
gacatcatttggccttcaggttttgtgtgcgacaactgcttgaagaaaactggcagacct
cgaaaagaaaacaaattcagtgctaagaggctgcagaccacaagactgggaaaccacttg
gaagaccgagtgaacaaatttttgcggcgccagaatcaccctgaagccggggaggttttt
gtccgagtggtggccagctcagacaagacggtggaggtcaagcccgggatgaagtcacgg
tttgtggattctggggaaatgtctgaatctttcccatatcgaaccaaagctctgtttgct
tttgaggaaattgacggcgtggatgtctgcttttttggaatgcacgtccaagaatacggc
tctgattgcccccctccaaacacgaggcgtgtgtacatttcttatctggatagtattcat
ttcttccggccacgttgcctccgcacagccgtttaccatgagatccttattggatattta
gagtatgtgaagaaattggggtatgtgacagggcacatctgggcctgtcctccaagtgaa
ggagatgattacatcttccattgccacccacctgatcaaaaaatacccaagccaaaacga
ctgcaggagtggtacaaaaagatgctggacaaggcgtttgcagagcggatcatccatgac
tacaaggatattttcaaacaagcaactgaagacaggctcaccagtgccaaggaactgccc
tattttgaaggtgatttctggcccaatgtgttagaagagagcattaaggaactagaacaa
gaagaagaggagaggaaaaaggaagagagcactgcagccagtgaaaccactgagggcagt
cagggcgacagcaagaatgccaagaagaagaacaacaagaaaaccaacaagaacaaaagc
agcatcagccgcgccaacaagaagaagcccagcatgcccaacgtgtccaatgacctgtcc
cagaagctgtatgccaccatggagaagcacaaggaggtcttcttcgtgatccacctgcac
gctgggcctgtcatcaacaccctgccccccatcgtcgaccccgaccccctgctcagctgt
gacctcatggatgggcgcgacgccttcctcaccctcgccagagacaagcactgggagttc
tcctccttgcgccgctccaagtggtccacgctctgcatgctggtggagctgcacacccag
ggccaggaccgctttgtctacacctgcaacgagtgcaagcaccacgtggagacgcgctgg
cactgcactgtgtgcgaggactacgacctctgcatcaactgctataacacgaagagccat
gcccataagatggtgaagtgggggctgggcctggatgacgagggcagcagccagggcgag
ccacagtcaaagagcccccaggagtcacgccggctgagcatccagcgctgcatccagtcg
ctggtgcacgcgtgccagtgccgcaacgccaactgctcgctgccatcctgccagaagatg
aagcgggtggtgcagcacaccaagggctgcaaacgcaagaccaacgggggctgcccggtg
tgcaagcagctcatcgccctctgctgctaccatgccaagcactgccaagaaaacaaatgc
cccgtgcccttctgcctcaacatcaaacacaagctccgccagcagcagatccagcaccgc
ctgcagcaggcccagctcatgcgccggcggatggccaccatgaacacccgcaacgtgcct
cagcagagtctgccttctcctacctcagcaccgcccgggacccccacacagcagcccagc
acaccccagacgccgcagccccctgcccagccccaaccctcacccgtgagcatgtcacca
gctggcttccccagcgtggcccggactcagccccccaccacggtgtccacagggaagcct
accagccaggtgccggcccccccacccccggcccagccccctcctgcagcggtggaagcg
gctcggcagatcgagcgtgaggcccagcagcagcagcacctgtaccgggtgaacatcaac
aacagcatgcccccaggacgcacgggcatggggaccccggggagccagatggcccccgtg
agcctgaatgtaccccgacccaaccaggtgagcgggcccgtcatgcccagcatgcctcct
gggcagtggcagcaggcgccccttccccagcagcagcccatgccaggcttgcccaggcct
gtgatatccatgcaggcccaggcggccgtggctgggccccggatgcccagtgtgcagcca
cccaggagcatctcacccagcgctctgcaagacctgctgcggaccctgaagtcgcccagc
tcccctcagcagcaacagcaggtgctgaacattctcaaatcaaacccgcagctaatggca
gctttcatcaaacagcgcacagccaagtacgtggccaatcagcccggcatgcagccccag
cctggcctccagtcccagcccggcatgcaaccccagcctggcatgcaccagcagcccagc
ctgcagaacctgaacgccatgcaggctggcgtgccgcggcccggtgtgcctccacagcag
caggcgatgggaggcctgaacccccagggccaggccttgaacatcatgaacccaggacac
aaccccaacatggcgagtatgaatccacagtaccgagaaatgttacggaggcagctgctg
cagcagcagcagcaacagcagcagcaacaacagcagcaacagcagcagcagcaagggagt
gccggcatggctgggggcatggcggggcacggccagttccagcagcctcaaggacccgga
ggctacccaccggccatgcagcagcagcagcgcatgcagcagcatctccccctccagggc
agctccatgggccagatggcggctcagatgggacagcttggccagatggggcagccgggg
ctgggggcagacagcacccccaacatccagcaagccctgcagcagcggattctgcagcaa
cagcagatgaagcagcagattgggtccccaggccagccgaaccccatgagcccccagcaa
cacatgctctcaggacagccacaggcctcgcatctccctggccagcagatcgccacatcc
cttagtaaccaggtgcggtctccagcccctgtccagtctccacggccccagtcccagcct
ccacattccagcccatcaccacggatacagccccagccttcgccacaccacgtctcaccc
cagactggttccccccaccccggactcgcagtcaccatggccagctccatagatcaggga
cacttggggaaccccgaacagagtgcaatgctcccccagctgaacacccccagcaggagt
gcactgtccagcgaactgtccctggtcggggacaccacgggggacacgctagagaagttt
gtggagggcttgtag

DBGET integrated database retrieval system