KEGG   Pan troglodytes (chimpanzee): 467926Help
Entry
467926            CDS       T01005                                 

Gene name
CHP2
Definition
calcineurin-like EF hand protein 2
Orthology
K17611  
calcineurin B homologous protein 2
Organism
ptr  Pan troglodytes (chimpanzee)
Brite
Protein phosphatases and associated proteins [BR:ptr01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     467926 (CHP2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
16
AA seq 196 aa AA seqDB search
MGSRSSHAAVIPDGDSIRRETGFSQASLLRLHHRFRALDRNKKGYLSRMDLQQIGALAVN
PLGDRIIESFFPDGSQRVDFPGFVRVLAHFRPVEDEDTETQDPKKPEPLNSRRNKLHYAF
QLYDLDRDGKTSRHEMLQVLRLMVGVQVTEEQLENIADRTVQEADEDGDGAVSFVEFTKS
LEKMDVEQKMSIRILK
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atggggtcgcgcagctcccacgccgcggtcattcccgacggggacagtattcggcgagag
accggcttctcccaagccagcctgctccgcctgcaccaccggttccgggcactggacagg
aataagaagggctacctgagccgcatggatctccagcagataggggcgctcgccgtgaac
cccctgggagaccgaattatagaaagcttcttccccgatgggagccagcgagtggatttc
ccaggctttgtcagggtcttggctcattttcgccctgtagaagatgaggacacagaaacc
caagaccccaagaaacctgaacctctcaacagcagaaggaacaaacttcactatgcattt
cagctctatgacctggatcgcgatgggaagacctccaggcatgagatgctgcaggttctc
cgtctgatggttggggtacaggtgacagaagagcagctggagaacatcgctgaccgcaca
gtgcaggaggctgatgaagatggggatggggctgtgtccttcgtggagttcaccaagtcc
ttagagaagatggacgttgagcaaaaaatgagcatccggatcctgaagtga

DBGET integrated database retrieval system