KEGG   Pan troglodytes (chimpanzee): 468043Help
Entry
468043            CDS       T01005                                 

Gene name
BCO1, BCMO1
Definition
(RefSeq) beta-carotene oxygenase 1
  KO
K00515  
beta-carotene 15,15'-monooxygenase [EC:1.14.99.36]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
Retinol metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ptr00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    468043 (BCO1)
Enzymes [BR:ptr01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.36  beta-carotene 15,15'-monooxygenase
     468043 (BCO1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
16
AA seq 491 aa AA seqDB search
MDIIFGRNRKEQQEPVRAKVTGKIPAWLQGTLLRNGPGMHTVGESRYNHWFDGLALLHSF
TIRDGEVYYRSKYLRSDTYNANIEANRIVVSEFGTMAYPDPCKNIFSKAFSYLSHTIPDF
TDNCLINIMKCGEDFYATSETNYIRKINPQTLETRRRCHILQVDYRKYVAVNLATSHPHY
DEAGNVLNMGTSIVEKGKTKYVIFKIPATVPGRPLSEPLMCVLFQTYIHIIDQKTRQPVQ
TKFYTDAMVVFHHVNAYEEDGCIVFDVIAYEDNSLYQLFYLANLNQDFKENSRLTSVPTL
RRFAVPLHVDKNAEVGSNLIKVASTTATALKEEDGQVYCQPEFLYEGLELPRVNYAHNGK
QYRYVFAAGVQWSPIPTKIIKYDILTKSSLKWREDDCWPAEPLFVPAPGAKDEDDGVILS
AIVSTDPQKLPFLLILDAKSFTELARASVDVDMHMDLHGLFITDMDWDTKKQAASEEQRD
RVSDCHGAPLT
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atggatataatatttggcaggaataggaaagaacagcaggagcctgtgagggccaaagtg
acaggcaagattccagcatggctgcagggaaccctgctccgcaacgggcctgggatgcac
acagttggggagtccagatacaaccattggttcgatggccttgccctgctccacagcttc
accatcagagacggtgaagtctattacaggagcaaatacctgagaagcgatacctacaac
gccaatattgaggcaaacaggattgtggtgtctgagtttggaacaatggcctatccggac
ccctgcaaaaacatattttccaaagctttctcctacttgtctcacaccatccccgatttc
accgacaactgcctgatcaacatcatgaagtgcggagaagacttctacgcgacctcagag
accaattacatcaggaaaatcaacccacagactctggaaacccggagaaggtgtcatatc
ttgcaggttgattatcgtaaatacgtggcggtaaatctggcaacgtcacatccccattat
gatgaggctggaaatgttctaaacatgggcacgtccattgtggaaaaggggaagacaaag
tatgtgatttttaagatccctgccacagtaccaggtaggccactctctgagcccttgatg
tgtgtcctttttcagacttatatccacatcatcgaccaaaagaccaggcagcctgtgcag
accaagttttacacagacgccatggtggttttccatcacgtcaacgcctacgaagaggac
ggctgcatcgtgtttgacgtcattgcctacgaggacaacagcctctaccagctcttctac
ctggccaacctgaaccaggacttcaaggagaactccaggctcacctcggtccccaccctc
aggagatttgccgtgcccctccacgtggacaagaatgcagaagtgggctcaaatttaatc
aaagtggcatctacaacagccacggccctgaaggaagaagatggccaagtctactgccag
ccggaatttctttatgaaggcttagagcttccacgggtcaattatgctcacaatggaaag
caataccgatatgtctttgctgcaggagttcagtggagtccaatcccaaccaagataata
aaatatgacattctcacaaagtcatccttaaaatggagagaggacgactgctggccagcg
gaacccctgtttgtgcccgcgccaggtgccaaggatgaggatgatggagtaatcttatca
gccattgtctctactgatccccaaaagctgccttttctgctcattctggatgccaaaagc
tttacggaattggcccgtgcctctgttgatgtcgatatgcacatggatctccatggatta
ttcattacagacatggactgggacacaaaaaagcaggccgcttctgaggaacagcgggac
agggtttccgactgccacggggctcctctgacctga

DBGET integrated database retrieval system