KEGG   Pan troglodytes (chimpanzee): 468101Help
Entry
468101            CDS       T01005                                 

Gene name
SETD1A
Definition
SET domain containing 1A
Orthology
K11422  
histone-lysine N-methyltransferase SETD1 [EC:2.1.1.43]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:ptr00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    468101 (SETD1A)
Enzymes [BR:ptr01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     468101 (SETD1A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
16
AA seq 1707 aa AA seqDB search
MDQEGGGDGQKAPSFQWRNYKLIVDPALDPALRRPSQKVYRYDGVHFSVNDSKYIPVEDL
QDPRCHVRSKNRDFSLPVPKFKLDEFYIGQIPLKEVTFARLNDNVRETFLKDMCRKYGEV
EEVEILLHPRTRKHLGLARVLFTSTRGAKETVKNLHLTSVMGNIIHAQLDIKGQQRMKYY
ELIVNGSYTPQTVPTGGKALSEKFQGSGAATETAESRRRSSSDTAAYPAGTTAVGTPGNG
TPCSQDTSFSSSRQDTPSSFGQFTPQSSQGTPYTSRGSTPYSQDSAYSSSTTSTSFKPRR
SENSYQDAFSRRHFSASSASTTASTAIAATTAATASSSASSSSLSSSSSSSSSSSSSQFR
SSDANYPAYYESWNRYQRHTSYPPRRATREEPPGAPFAENTAERFPPSYTSYLPPEPSRP
TDQDYRPPASEAPPPEPPEPGGGGGGGGPSPEREEVRTSPRPASPARSGSPAPETTNESV
PFAQHSSLDSRIEMLLKEQRSKFSFLASDTEEEEENSSMVLGARDTGSEVPSGSGHGPCT
PPPAPANFEDVAPTGSGEPGATRESPKANGQNQASPCSSGDDMEISDDDRGGSPAPAPTP
PQQPPPPPPPPPPPPPYLASLPLGYPPHQPAYLLPPRPDGPPPPEYPPPPPPPPHIYDFV
NSLELMDRLGAQWGGMPMSFQMQTQMLTRLHQLRQGKGLIAASAGPPGGAFGEAFLPFPP
PQEAAYGLPYALYAQGQEGRGAYSREAYHLPMPMAAEPLPSSSVSGEEARLPPREEAELA
EGKTLPTAGTVGRVLAMLVQEMKSIMQRDLNRKMVENVAFGAFDQWWESKEEKAKPFQNA
AKQQAKEEDKEKTKLKEPGLLSLVDWAKSGGTTGIEAFAFGSGLRGALRLPSFKVKRKEP
SEISEASEEKRPRPSTPAEEDEDDPEQEKEAGEPGRPGTKPPKRDEERGKTQGKHRKSFA
LDSEGEEASQESSSEKDEEDDEEDEEDEDREEAVDTTKKETGVSDGEDEESDSSSKCSLY
ADSDGENDSTSDSESSSSSSSSSSSSSSSSSSSSSSSSESSSEDEEEEERPAALPSASPP
PREVPVPTPAPVEVPVPERVAGSPVTPLPEQEASPARPAGPTEESPPSVPLPPPEPPAGP
PAPAPCPDERPSSPIPLLPPPKKRRKTVSFSAIEVVPAPEPPPATPPQAKFPGPASRKAP
RGVERTIRNLPLDHASLVKSWPEEVSRGGRSRAGGRGRATEEEEAEPGTEVDLAVLADLA
LTPARRGLPALPAVEDSEATETSDEAERPGPLLSHILLEHNYALAVKPTPPAPALRPPEP
VPAPAALFSSPADEVLEAPEVVVAEAEEPKPQQLQQQREEGEEEGEEEGEEEEEESSDSS
SSSDGEGALRRRSLRSHARRRRPPPPPPPPPPRAYEPRSEFEQMTILYDIWNSGLDSEDM
SYLRLTYERLLQQTSGADWLNDTHWVHHTITNLTTPKRKRRPQDGPREHQTGSARSEGYY
PISKKEKDKYLDVCPVSARQLEGVDTQGTNRVLSERRSEQRRLLSAIGTSAIMDSDLLKL
NQLKFRKKKLRFGRSRIHEWGLFAMEPIAADEMVIEYVGQNIRQMVADMREKRYVQEGIG
SSYLFRVDHDTIIDATKCGNLARFINHCCTPNCYAKVITIESQKKIVIYSKQPIGVDEEI
TYDYKFPLEDNKIPCLCGTESCRGSLN
NT seq 5124 nt NT seq  +upstreamnt  +downstreamnt
atggatcaggaaggtgggggagatgggcagaaggccccgagcttccagtggcggaactac
aagctcatcgtggatcctgccttggaccctgccctgcgcaggccttctcagaaggtgtac
cgctatgatggagtccacttcagtgtcaacgactcaaagtatataccagtcgaagacctc
caagacccccgttgccatgtcaggtccaaaaacagagacttttccctcccagtccctaag
tttaagctggacgagttctatattggacagattccactgaaggaagtgacttttgcaagg
ctgaatgacaacgtgcgggagaccttcctgaaggatatgtgccgtaagtacggtgaggtg
gaagaggtagagatcctccttcacccccgtacgcgcaagcacctgggcctggcccgtgtg
ctcttcaccagcactcggggcgccaaggaaacggtcaaaaacctccaccttacctccgtc
atgggcaacatcatccatgcccagcttgacatcaaaggacaacaacgaatgaaatactat
gaactaattgtcaatggctcctacacccctcagactgtgcccactgggggcaaggccctg
agtgagaagttccaaggctcgggtgcagccactgagacggctgaatcccgccgccgctct
tcctctgacacagctgcctacccagcaggcaccactgcggtgggcactcctggcaacggc
acgccctgctcccaggacacaagcttctccagcagccgacaagataccccatcttccttt
ggccagttcacacctcagtcctcccaaggaaccccctacacgtctcggggcagcaccccc
tactctcaggactccgcctactccagcagcaccacttcaacctccttcaagccccggcgg
tcagagaacagctaccaagatgccttttcccgccgccacttctctgcatcttcagcctcc
acaaccgcctccacggccattgccgccaccactgcagccactgcctcatcctccgcctct
tcctcctcattgtcctcgtcctcctcgtcgtcctcttcctcctcgtcctctcagtttcgt
agttctgatgcaaactacccagcgtattatgaaagctggaatcgctaccagcgccatact
tcctacccaccacgccgggccacacgggaggaaccccctggagccccttttgctgaaaat
acagctgagcgcttcccaccttcctacacctcctacctgccccccgagcccagccggccc
accgaccaggactaccggcctcctgcctcagaggctccacccccggagcctccagaacct
ggtggaggcgggggtggaggagggcccagccctgagagagaagaagttcggacttccccc
cgcccagcctcacctgcccgctctggctccccagccccggagaccaccaatgagagtgtg
cccttcgcccagcacagcagcctggattcccgcatcgagatgctgctgaaggagcagcgc
tccaagttttccttcctggcctctgacacagaggaggaggaagagaacagcagcatggtc
cttggggccagagatacagggagtgaggtgccttctgggtcagggcatgggccctgcaca
ccccctccggccccagctaattttgaggatgtggcacctacagggagcggggagccaggg
gctacccgggagtctcccaaggcaaatggacagaaccaggcttctccatgctcttctgga
gacgacatggagatctccgacgacgaccggggtggctcacccgctccggccccgacgccc
cctcagcagcctccgccacctccccctcccccgcctcctcctcctccctacctggcgtcc
cttcctcttggttatcctccccaccaacctgcctacctcctcccacccagacctgatggg
ccgccaccccctgagtaccccccacctcctccaccacccccgcacatctatgactttgtg
aactccctggagctcatggaccgacttggggctcagtggggagggatgcccatgtccttt
cagatgcagacccagatgttaactcggctccatcagctgcggcagggcaagggattgatt
gccgcctcagctggcccccccggtggggcctttggggaggccttcctcccgtttccaccc
ccgcaggaggcagcctacggcttgccgtatgctctatatgcacaggggcaggagggcaga
ggggcatactcacgggaggcctaccacctgcccatgccaatggcagccgagcccctgccc
tcctcctcagtctcgggagaggaggcccggctgccacccagggaagaagcagaactggca
gagggcaagaccctcccgacggcaggcaccgtgggccgtgtgctcgccatgctggtccag
gagatgaagagcatcatgcagcgagacctcaaccgcaagatggtggagaacgtggccttc
ggagcctttgaccagtggtgggagagcaaggaggagaaggccaagccattccagaacgcg
gccaagcagcaagccaaggaggaggataaagagaagacgaagctgaaggagcctggcctg
ctgtccctcgtggactgggccaagagcgggggcactacgggcatcgaggctttcgccttt
gggtcagggctgagaggggccctgcggctgccttcattcaaggtaaagcggaaagagcca
tcggaaatttctgaggccagtgaggaaaagaggcctcgtccctccactcctgctgaggaa
gatgaagacgaccctgaacaagagaaggaggctggagagcccggacgtccggggaccaag
cccccgaagcgggacgaagagcgaggcaagacccagggcaagcaccgcaagtcctttgct
ctggacagcgaaggggaggaggcatcccaggagtcctcctcggagaaggatgaggaggat
gacgaggaagatgaggaagatgaagatcgagaggaagctgtggataccacaaagaaggag
acaggggtgtcggatggcgaggacgaggaaagcgattcgtcttccaaatgttctctgtat
gctgactcagatggcgaaaatgacagcacatcagactccgagagcagcagctcttccagc
tcctcatcctcctcctcctcctcgtcctcatcctcctcgtcctcttcatcctctgagtcc
tcctctgaagatgaagaggaagaggagcggccagcagcccttccctcagcctccccaccc
cccagagaagtcccagtgcccacgccagcacctgtggaggtgccagtgccggagagggtt
gcaggctccccagtcacacccctgcccgaacaggaggcgtctccagcaaggcctgcaggc
cccacggaggagtcaccccccagtgtgcccctgcctcccccagaaccacctgctgggccc
ccggcccctgccccatgccccgatgagcgtccctcttctcccatccccctcctgccccca
cccaagaaacgccggaaaactgtctccttctctgccatcgaggtggtgccagccccggag
ccccctccagccacaccgccgcaggccaagtttcctggcccagcctcccgcaaggctccc
cggggcgtggagcggaccatccgcaacctgcccctggaccacgcatctctggtcaagagt
tggcccgaggaggtgtcccgaggaggccggagccgggctggaggccgaggccgcgccacc
gaggaagaggaggctgagccagggacagaggtggacctggcggtcctggccgacctggcc
ctgacccctgcccggcgcgggctgcctgccctgcctgctgttgaagactcagaggccaca
gagacatcggacgaggccgagcgccctgggcccctgctcagccacatcctcctggagcac
aactatgccctggccgtcaagcccacgccccctgcgccagccctgcggcccccggagcca
gtgcccgcacccgccgccctcttcagttccccagctgatgaggtcctggaggcccctgag
gtggtggtggctgaggcggaggagcccaagccgcagcaactgcagcagcagcgggaggag
ggcgaagaggagggggaggaagagggggaggaagaggaggaggagtcctctgacagcagc
agcagcagcgatggggagggcgccctccggaggcgcagcctccgctcccacgcccggcgc
cgccgccctccgcccccacccccgccgccaccgccccgcgcctacgagccacgcagtgag
tttgaacagatgaccatcctgtatgacatttggaactcgggcctggactcagaggacatg
agttacctgcggcttacgtacgagcggctgctgcagcagacaagcggggctgactggctc
aacgacactcactgggtccatcacacaatcaccaacctgaccaccccaaaacgcaagcgg
cggccccaggacgggccccgggagcaccagacaggctcagcccgcagcgaaggctactac
cccatcagcaagaaggagaaggacaagtacctggacgtgtgcccagtctcggcccggcag
ctggagggcgtggacactcaggggacgaaccgcgtgctgtccgagcgccggtccgagcag
cggcggctgctgagcgccatcggtacctccgctatcatggacagtgacctgctgaaactc
aaccagctcaagttccggaagaagaagctccgatttggccggagccgaatccacgagtgg
ggtctgtttgccatggaacccattgctgctgacgagatggtcatcgaatacgtgggtcag
aacatccgtcagatggtggccgacatgcgggagaagcgctacgtgcaggagggcattggc
agcagctacctgttccgggtggaccacgacaccatcatcgatgccaccaagtgtggcaac
ctggccagattcatcaaccactgctgcacgcccaactgctacgccaaggtcatcaccatc
gagtcccagaagaaaatcgtgatctactccaagcagcccattggcgtggacgaggagatc
acctacgactacaagttcccactggaagacaacaagatcccgtgtctgtgtggcacggag
agctgccggggctccctaaactga

DBGET integrated database retrieval system