KEGG   Pan troglodytes (chimpanzee): 468102Help
Entry
468102            CDS       T01005                                 

Gene name
KAT8
Definition
K(lysine) acetyltransferase 8
Orthology
K11308  
histone acetyltransferase MYST1 [EC:2.3.1.48]
Organism
ptr  Pan troglodytes (chimpanzee)
Brite
Enzymes [BR:ptr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     468102 (KAT8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
16
AA seq 454 aa AA seqDB search
MAAQGAAAAVAAATSGVAGEGEPGPGENAAAEGTAPSPGRVSPPTPARGEPEVTVEIGET
YLCRRPDSTWHSAEVIQSRVNDQEGREEFYVHYVGFNRRLDEWVDKNRLALTKTVKDAVQ
KNSEKYLSELAEQPERKITRNQKRKHDEINHVQKTYAEMDPTTAALEKEHEAITKVKYVD
KIHIGNYEIDAWYFSPFPEDYGKQPKLWLCEYCLKYMKYEKSYRFHLGQCQWRQPPGKEI
YRKSNISVYEVDGKDHKIYCQNLCLLAKLFLDHKTLYFDVEPFVFYILTEVDRQGAHIVG
YFSKVLGLETRGEDPQRKQCGCFCLAPTTPRLGKFSLLVMELSKLESTSAPPEKPLSDLG
KLSYRSYWSXVLLEILRDFRGTLSIKGPQNDIISTLQSLNMVKYWKGQHVICVTPKLVEE
HLKSAQYKKPPITVDSVCLKWAPPKHKQVKLSKK
NT seq 1365 nt NT seq  +upstreamnt  +downstreamnt
atggcggcacagggagctgctgcggcggttgcagcggcgacttcaggggtcgcgggggag
ggcgagcccgggcccggggagaatgcggccgctgaggggaccgccccatccccgggccgc
gtctctccgccgaccccggcgcgcggcgagccggaagtcacggtggagatcggagaaacg
tacctgtgccggcgaccggatagcacctggcattctgctgaagtgatccagtctcgagtg
aacgaccaggagggccgagaggaattctatgtacactacgtgggctttaaccggcggctg
gacgagtgggtagacaagaaccggctggcgctgaccaagacagtgaaggatgctgtacag
aagaactcagagaagtacctgagcgagctcgcagagcagcctgagcgcaagatcactcgc
aaccaaaagcgcaagcatgatgagatcaaccatgtgcagaagacttatgcagagatggac
cccaccacagcagccttggagaaggagcatgaggcgatcaccaaggtgaagtatgtggac
aagatccacatcgggaactacgaaattgatgcctggtatttctcaccattccccgaagac
tatgggaaacagcccaagctctggctctgcgagtactgcctcaagtacatgaaatatgag
aagagctaccgcttccacttgggtcagtgccagtggcggcagccccccgggaaagagatc
taccgcaagagcaacatctccgtgtacgaagttgatggcaaagaccataagatttactgt
cagaacctgtgtctgctggccaagcttttcctggaccataagacactgtactttgacgtg
gagccgttcgtcttttacatcctgactgaggtggaccggcagggggcccacattgttggc
tacttctccaaggtgctgggtctggaaactcggggagaggatccccaaaggaaacaatgt
ggctgcttctgtcttgcccctacaaccccgcgactcgggaagttctctcttttagttatg
gagctctccaagctggagagcacgtcggctcccccggagaagccgctgtctgacctgggc
aagctcagctaccgcagctactggtcttgagtgctgctggagatcctgcgggacttccgg
ggcacactgtccatcaaaggacctcagaatgacatcatcagtaccctgcaatccctcaat
atggtcaagtactggaagggccagcacgtgatctgtgtcacacccaagctggtggaggag
cacctcaaaagtgcccagtataagaaaccacccatcacagtggactccgtctgcctcaag
tgggcaccccccaagcacaagcaagtcaagctctccaagaagtga

DBGET integrated database retrieval system