KEGG   Pan troglodytes (chimpanzee): 468102Help
Entry
468102            CDS       T01005                                 

Gene name
KAT8
Definition
(RefSeq) lysine acetyltransferase 8
  KO
K11308  
histone acetyltransferase MYST1 [EC:2.3.1.48]
Organism
ptr  Pan troglodytes (chimpanzee)
Brite
Enzymes [BR:ptr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     468102 (KAT8)
Chromosome [BR:ptr03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    468102 (KAT8)
   HAT complexes
    NSL complex
     468102 (KAT8)
    MSL complex
     468102 (KAT8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
16
AA seq 467 aa AA seqDB search
MAAQGAAAAVAAATSGVAGEGEPGPGENAAAEGTAPSPGRVSPPTPARGEPEVTVEIGET
YLCRRPDSTWHSAEVIQSRVNDQEGREEFYVHYVGFNRRLDEWVDKNRLALTKTVKDAVQ
KNSEKYLSELAEQPERKITRNQKRKHDEINHVQKTYAEMDPTTAALEKEHEAITKVKYVD
KIHIGNYEIDAWYFSPFPEDYGKQPKLWLCEYCLKYMKYEKSYRFHLGQCQWRQPPGKEI
YRKSNISVYEVDGKDHKIYCQNLCLLAKLFLDHKTLYFDVEPFVFYILTEVDRQGAHIVG
YFSKEKESPDGNNVACILTLPPYQRRGYGKFLIAFSYELSKLESTVGSPEKPLSDLGKLS
YRSYWSWVLLEILRDFRGTLSIKDLSQMTSITQNDIISTLQSLNMVKYWKGQHVICVTPK
LVEEHLKSAQYKKPPITGGWGAAVCRGWWGSVSIWTGRSQGLLIAVT
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
atggcggcacagggagctgctgcggcggttgcagcggcgacttcaggggtcgcgggggag
ggcgagcccgggcccggggagaatgcggccgctgaggggaccgccccatccccgggccgc
gtctctccgccgaccccggcgcgcggcgagccggaagtcacggtggagatcggagaaacg
tacctgtgccggcgaccggatagcacctggcattctgctgaagtgatccagtctcgagtg
aacgaccaggagggccgagaggaattctatgtacactacgtgggctttaaccggcggctg
gacgagtgggtagacaagaaccggctggcgctgaccaagacagtgaaggatgctgtacag
aagaactcagagaagtacctgagcgagctcgcagagcagcctgagcgcaagatcactcgc
aaccaaaagcgcaagcatgatgagatcaaccatgtgcagaagacttatgcagagatggac
cccaccacagcagccttggagaaggagcatgaggcgatcaccaaggtgaagtatgtggac
aagatccacatcgggaactacgaaattgatgcctggtatttctcaccattccccgaagac
tatgggaaacagcccaagctctggctctgcgagtactgcctcaagtacatgaaatatgag
aagagctaccgcttccacttgggtcagtgccagtggcggcagccccccgggaaagagatc
taccgcaagagcaacatctccgtgtacgaagttgatggcaaagaccataagatttactgt
cagaacctgtgtctgctggccaagcttttcctggaccataagacactgtactttgacgtg
gagccgttcgtcttttacatcctgactgaggtggaccggcagggggcccacattgttggc
tacttctccaaggagaaggagtccccagatggaaacaatgtggcctgcatcctgaccttg
cccccctaccaacgccgcggctacgggaagttcctcatcgctttcagttatgagctctcc
aagctggagagcacggtcggctccccggagaagccgctgtctgacctgggcaagctcagc
taccgcagctactggtcctgggtgctgctggagatcctgcgggacttccggggcacactg
tccatcaaggacctcagccagatgaccagtatcacccaaaatgacatcatcagtaccctg
caatccctcaatatggtcaagtactggaagggccagcacgtgatctgtgtcacacccaag
ctggtggaggagcacctcaaaagtgcccagtataagaaaccacccatcacaggtgggtgg
ggggctgctgtgtgtcgggggtggtgggggagtgtcagtatatggactggtaggagtcaa
ggcctccttattgctgtcacatga

DBGET integrated database retrieval system