KEGG   Pan troglodytes (chimpanzee): 468102Help
Entry
468102            CDS       T01005                                 

Gene name
KAT8
Definition
(RefSeq) histone acetyltransferase KAT8 isoform X2
  KO
K11308  histone acetyltransferase MYST1 [EC:2.3.1.48]
Organism
ptr  Pan troglodytes (chimpanzee)
Brite
Enzymes [BR:ptr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     468102 (KAT8)
Chromosome and associated proteins [BR:ptr03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    468102 (KAT8)
   HAT complexes
    NSL complex
     468102 (KAT8)
    MSL complex
     468102 (KAT8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MOZ_SAS Tudor-knot Myosin_head Acetyltransf_7 HTH_9 SAWADEE
Motif
Other DBs
NCBI-GeneID: 468102
NCBI-ProteinID: XP_016785235
UniProt: K7DPR6
Position
16
AA seq 458 aa AA seqDB search
MAAQGAAAAVAAATSGVAGEGEPGPGENAAAEGTAPSPGRVSPPTPARGEPEVTVEIGET
YLCRRPDSTWHSAEVIQSRVNDQEGREEFYVHYVGFNRRLDEWVDKNRLALTKTVKDAVQ
KNSEKYLSELAEQPERKITRNQKRKHDEINHVQKTYAEMDPTTAALEKEHEAITKVKYVD
KIHIGNYEIDAWYFSPFPEDYGKQPKLWLCEYCLKYMKYEKSYRFHLGQCQWRQPPGKEI
YRKSNISVYEVDGKDHKIYCQNLCLLAKLFLDHKTLYFDVEPFVFYILTEVDRQGAHIVG
YFSKEKESPDGNNVACILTLPPYQRRGYGKFLIAFSYELSKLESTVGSPEKPLSDLGKLS
YRSYWSWVLLEILRDFRGTLSIKDLSQMTSITQNDIISTLQSLNMVKYWKGQHVICVTPK
LVEEHLKSAQYKKPPITVDSVCLKWAPPKHKQVKLSKK
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
atggcggcacagggagctgctgcggcggttgcagcggcgacttcaggggtcgcgggggag
ggcgagcccgggcccggggagaatgcggccgctgaggggaccgccccatccccgggccgc
gtctctccgccgaccccggcgcgcggcgagccggaagtcacggtggagatcggagaaacg
tacctgtgccggcgaccggatagcacctggcattctgctgaagtgatccagtctcgagtg
aacgaccaggagggccgagaggaattctatgtacactacgtgggctttaaccggcggctg
gacgagtgggtagacaagaaccggctggcgctgaccaagacagtgaaggatgctgtacag
aagaactcagagaagtacctgagcgagctcgcagagcagcctgagcgcaagatcactcgc
aaccaaaagcgcaagcatgatgagatcaaccatgtgcagaagacttatgcagagatggac
cccaccacagcagccttggagaaggagcatgaggcgatcaccaaggtgaagtatgtggac
aagatccacatcgggaactacgaaattgatgcctggtatttctcaccattccccgaagac
tatgggaaacagcccaagctctggctctgcgagtactgcctcaagtacatgaaatatgag
aagagctaccgcttccacttgggtcagtgccagtggcggcagccccccgggaaagagatc
taccgcaagagcaacatctccgtgtacgaagttgatggcaaagaccataagatttactgt
cagaacctgtgtctgctggccaagcttttcctggaccataagacactgtactttgacgtg
gagccgttcgtcttttacatcctgactgaggtggaccggcagggggcccacattgttggc
tacttctccaaggagaaggagtccccagatggaaacaatgtggcctgcatcctgaccttg
cccccctaccaacgccgcggctacgggaagttcctcatcgctttcagttatgagctctcc
aagctggagagcacggtcggctccccggagaagccgctgtctgacctgggcaagctcagc
taccgcagctactggtcctgggtgctgctggagatcctgcgggacttccggggcacactg
tccatcaaggacctcagccagatgaccagtatcacccaaaatgacatcatcagtaccctg
caatccctcaatatggtcaagtactggaagggccagcacgtgatctgtgtcacacccaag
ctggtggaggagcacctcaaaagtgcccagtataagaaaccacccatcacagtggactcc
gtctgcctcaagtgggcaccccccaagcacaagcaagtcaagctctccaagaagtga

DBGET integrated database retrieval system