KEGG   Pan troglodytes (chimpanzee): 468279Help
Entry
468279            CDS       T01005                                 

Gene name
PLCD3
Definition
(RefSeq) phospholipase C, delta 3
  KO
K05857  
phosphatidylinositol phospholipase C, delta [EC:3.1.4.11]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
Inositol phosphate metabolism
Metabolic pathways
Calcium signaling pathway
Phosphatidylinositol signaling system
Thyroid hormone signaling pathway
Module
Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:ptr00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    468279 (PLCD3)
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    468279 (PLCD3)
   04070 Phosphatidylinositol signaling system
    468279 (PLCD3)
 Organismal Systems
  Endocrine system
   04919 Thyroid hormone signaling pathway
    468279 (PLCD3)
Enzymes [BR:ptr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     468279 (PLCD3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
17
AA seq 789 aa AA seqDB search
MLCGRWRRCRRPPEEPPVAAQVAAQVAAPVALPSPPTPSDGGTKRPGLRALKKMGLTEDE
DVRAMLRGSRLRKIRSRTWHKERLYRLQEDGLSVWFQRRIPRAPSQHIFFVQHIEAVREG
HQSEGLRRFGGAFAPARCLTIAFKGRRKNLDLAAPTAEEAQRWVRGLTKLRARLDAMSQR
ERLDHWIHSYLHRADSNQDSKMSFKEIKSLLRMVNVDMNDMYAYLLFKECDHSNNDRLEG
AEIEEFLRRLLKRPELEEIFHQYSGEDRVLSAPELLEFLEDQGEEGATLARAQQLIQTYE
LNETAKQHELMTLDGFMMYLLSPEGAALDNTHTCVFQDMNQPLAHYFISSSHNTYLTDSQ
IGGPSSTEAYVRAFAQGCRCVELDCWEGPGGEPVIYHGHTLTSKILFRDVVQAVRDHAFT
LSPYPVILSLENHCGLEQQAAMARHLCTILGDMLVTQALDSPNPEELPSPEQLKGRVLVK
GKKLPAARSEDGRALSDREEEEEEEEEEEEEVEAAAQRRLAKQISPELSALAVYCHATRL
RTLHPAPNTPQPCQVSSLSERKAKKLIREAGNSFVRHNARQLTRVYPLGLRMNSANYSPQ
EMWNSGCQLVALNFQTPGYEMDLNAGRFLVNGQCGYVLKPACLRQPDSTFDPEYPGPPRT
TLSIQVLTAQQLPKLNAEKPHSIVDPLVRVEIHGVPADCARQETDYVLNNGFNPRWGQTL
QFQLRAPELALVRFVVEDYDATSPNDFVGQFTLPLSSLKQGYRHIHLLSKDGASLSPATL
FIQIRIQCS
NT seq 2370 nt NT seq  +upstreamnt  +downstreamnt
atgctgtgcggccgctggaggcgctgccgccgcccgcccgaggagcccccggtggccgcc
caggtcgcagcccaagtcgcggcgccggtcgctctcccgtccccgccgactccctccgat
ggcggcaccaagaggcccgggctgcgggcgctgaagaagatgggcctgacggaggacgag
gacgtgcgcgccatgctgcggggctcccggctccgcaagatccgctcgcgcacgtggcac
aaggagcggctgtaccggctgcaggaggacggcctgagcgtgtggttccagcggcgcatc
ccgcgtgcgccatcgcagcacatcttcttcgtgcagcacatcgaggcggtccgcgagggc
caccagtccgagggcctgcggcgcttcgggggtgccttcgcgccggcgcgctgcctcacc
atcgccttcaagggccgccgcaagaacctggacctggcggcgcccacggctgaggaagcg
cagcgctgggtgcgcggtctgaccaagctccgcgcgcgcctggacgccatgagccagcgc
gagcggctagaccactggatccactcctatctgcaccgggctgactccaaccaggacagc
aagatgagcttcaaggagatcaagagcctgctgagaatggtcaacgtggacatgaacgac
atgtacgcctacctcctcttcaaggagtgtgaccactccaacaacgaccgtctagagggg
gctgagatcgaggagttcctgcggcggctgctgaagcggccggagctggaggagatcttc
catcagtactcgggcgaggaccgcgtgctgagtgcccccgagctgctggagttcctggag
gaccagggcgaggagggcgccacactggcccgcgcccagcagctcattcagacctatgag
ctcaacgagacagccaagcagcatgagctgatgacactggatggcttcatgatgtacctg
ttgtcgccagagggggctgccttggacaacacccacacgtgtgtgttccaggacatgaac
cagcccctcgcccactacttcatctcttcctcccacaacacctatctgactgactcccag
atcggggggcccagcagcaccgaggcctacgttagggcctttgcccagggatgccgctgc
gtggagctggactgctgggaggggccaggaggggagcccgtcatctatcatggccatacc
ctcacctccaagattctcttccgggacgtggtccaagccgtgcgcgaccatgccttcacg
ctgtccccttaccctgtcatcctatccctggagaaccactgcgggctggagcagcaggct
gccatggcccgccacctctgcaccatcctgggggacatgctggtgacacaggcgctggac
tccccaaatcccgaggagctgccatccccagagcagctgaagggccgggtcctggtgaag
ggaaagaagctgcccgctgctcggagcgaggatggccgggctctgtcggatcgggaggag
gaggaggaggaggaggaggaggaggaagaggaggtggaggctgcagcgcagaggcggctg
gccaagcagatctccccggagctgtcggccctggctgtgtactgccacgccacccgcctg
cggaccctgcaccctgcccccaacaccccgcaaccctgccaggtcagctccctcagcgag
cgcaaagccaagaaactcattcgggaggcagggaacagctttgtcaggcacaatgcccgc
cagctgacccgcgtgtacccgctggggctgcggatgaactcagccaactacagtccccag
gagatgtggaactcgggctgtcagctggtggccttgaacttccagacgccaggctacgag
atggacctcaatgccgggcgcttcctagtcaatgggcagtgtggctacgtcctaaaacct
gcctgcctgcggcaacctgactcgacctttgaccctgagtacccgggacctcccagaacc
actctcagcatccaggtgctgactgcacagcagctacccaagctgaatgccgagaagcca
cactccattgtggaccccctggtgcgcgttgagatccatggggtgcccgcagactgtgcc
cggcaggagactgactacgtgctcaacaatggcttcaacccccgctgggggcagaccctg
cagttccagctgcgggctccggagctggcactggtccggtttgtggtagaagattatgac
gccacctcccccaatgactttgtgggccagtttacactgcctcttagcagcctaaagcaa
gggtaccgccacatacacctgctttccaaggacggggcctcactgtcaccagccacgctc
ttcatccaaatccgcatccagtgctcctga

DBGET integrated database retrieval system