KEGG   Pan troglodytes (chimpanzee): 468310Help
Entry
468310            CDS       T01005                                 

Gene name
MAP2K6
Definition
mitogen-activated protein kinase kinase 6
Orthology
K04433  
mitogen-activated protein kinase kinase 6 [EC:2.7.12.2]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
MAPK signaling pathway
Rap1 signaling pathway
Osteoclast differentiation
Toll-like receptor signaling pathway
Fc epsilon RI signaling pathway
TNF signaling pathway
Inflammatory mediator regulation of TRP channels
GnRH signaling pathway
Amyotrophic lateral sclerosis (ALS)
Toxoplasmosis
Influenza A
Epstein-Barr virus infection
Module
MAPK (p38) signaling
Brite
KEGG Orthology (KO) [BR:ptr00001]
 Environmental Information Processing
  Signal transduction
   04015 Rap1 signaling pathway
    468310 (MAP2K6)
   04010 MAPK signaling pathway
    468310 (MAP2K6)
   04668 TNF signaling pathway
    468310 (MAP2K6)
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    468310 (MAP2K6)
   04664 Fc epsilon RI signaling pathway
    468310 (MAP2K6)
  Endocrine system
   04912 GnRH signaling pathway
    468310 (MAP2K6)
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    468310 (MAP2K6)
  Development
   04380 Osteoclast differentiation
    468310 (MAP2K6)
 Human Diseases
  Neurodegenerative diseases
   05014 Amyotrophic lateral sclerosis (ALS)
    468310 (MAP2K6)
  Infectious diseases
   05164 Influenza A
    468310 (MAP2K6)
   05169 Epstein-Barr virus infection
    468310 (MAP2K6)
   05145 Toxoplasmosis
    468310 (MAP2K6)
Enzymes [BR:ptr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     468310 (MAP2K6)
Protein kinases [BR:ptr01001]
 Serine/threonine protein kinases: STE group
  STE7 family
   468310 (MAP2K6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
17
AA seq 278 aa AA seqDB search
MELGRGAYGVVEKMRHVPSGQIMAVKRIRATVNSQEQKRLLMDLDISMRTVDCPFTVTFY
GALFREGDVWICMELMDTSLDKFYKQVIDKGQTIPEDILGKIAVSIVKALEHLHSKLSVI
HRDVKPSNVLINALGQVKMCDFGISGYLVDSVAKTIDAGCKPYMAPERINPELNQKGYSV
KSDIWSLGITMIELAILRFPYDSWGTPFQQLKQVVEEPSPQLPADKFSAEFVDFTSQCLK
KNSKERPTYPELMQHPFFTLHESKGTDVASFVKLILGD
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atggaactgggacgaggtgcgtacggggtggtggagaagatgcggcacgtgcccagcggg
cagatcatggcagtgaagcggatccgagccacagtaaatagccaggaacagaaacggcta
ctgatggatttggatatttccatgaggacggtggactgtccattcactgtcaccttttat
ggcgcactgtttcgggagggtgatgtgtggatctgcatggagctcatggatacatcacta
gataaattctacaaacaagttattgataaaggccagacaattccagaggacatcttaggg
aaaatagcagtttctattgtaaaagcattagaacatttacatagtaagctgtctgtcatt
cacagagatgtcaagccttctaatgtactcatcaatgctctcggtcaagtgaagatgtgc
gattttggaatcagtggctacttggtggactctgttgctaaaacaattgatgcaggttgc
aaaccatacatggcccctgaaagaataaacccagagctcaaccagaagggatacagtgtg
aagtctgacatttggagtctgggcatcacgatgattgagttggccatccttcgatttccc
tatgattcatggggaactccatttcagcagctcaaacaggtggtagaggagccatcgcca
caactcccagcagacaagttctctgcagagtttgttgactttacctcacagtgcttaaag
aagaattccaaagaacggcctacatacccagagctaatgcaacatccatttttcacccta
catgaatccaaaggaacagatgtggcatcttttgtaaaactgattcttggagactaa

DBGET integrated database retrieval system