KEGG   Pan troglodytes (chimpanzee): 468402Help
Entry
468402            CDS       T01005                                 

Gene name
PDK2
Definition
pyruvate dehydrogenase kinase, isozyme 2
Orthology
K00898  
pyruvate dehydrogenase kinase 2/3/4 [EC:2.7.11.2]
Organism
ptr  Pan troglodytes (chimpanzee)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
17
AA seq 343 aa AA seqDB search
MKEINLLPDRVLSTPSVQLVQSWYVQSLLDIMEFLDKDPEDHRTLSQFTDALVTIRNRHN
DVVPTMAQGVLEYKDTYGDDPVSNQNIQYFLDRFYLSRISIRMLINQHTLIFDGSTNPAH
PKHIGSIDPNCNVSEVVKDAYDMAKLLCDKYYMASPDLEIQEINAANSKQPIHMVYVPSH
LYHMLFELFKNAMRATVESHESSLILPPIKVMVALGEEDLSIKMSDRGGGVPLRKIERLF
SYMYSTAPTPQPGTGGTPLAGFGYGLPISRLYAKYFQGDLQLFSMEGFGTDAVIYLKALS
TDSVERLPVYNKSAWRHYQTIQEAGDWCVPSTEPKNTSTYRVS
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgaaagagatcaacctgcttcccgaccgagtgctgagcacaccctctgtgcagctggtg
cagagctggtatgtccagagcctcctggacatcatggagttcctggacaaggatcccgag
gaccatcgcaccctgagccagttcactgacgccctggtcaccatccggaaccggcacaac
gacgtggtgcccaccatggcacaaggcgtgcttgagtacaaggacacctacggcgatgac
cccgtctccaaccagaacatccagtacttcctggaccgcttctacctcagccgcatctcc
atccgcatgctcatcaaccagcacaccctcatctttgatggcagcaccaacccagcccat
cccaaacacatcggcagcatcgaccccaactgcaacgtctctgaggtggtcaaagatgcc
tacgacatggctaagctcctgtgtgacaagtattacatggcctcacctgacctggagatc
caggagatcaatgcagccaactccaaacagccgattcacatggtctacgtcccctcccac
ctctaccacatgctctttgagctcttcaagaatgccatgagggcgactgtggaaagccat
gagtccagcctcattctcccacccatcaaggtcatggtggccttgggcgaggaagatctg
tccatcaagatgagtgaccgaggtgggggtgttcccttgaggaagattgagcgactcttc
agctacatgtactccacagcacccaccccccagcctggcactgggggaacgccgctggct
ggctttggttatgggctccccatttcccgcctctacgccaagtacttccagggagacctg
cagctcttctccatggaaggctttgggaccgatgctgtcatctatctcaaggccctgtcc
acggactcggtggagcgcctgcctgtctacaacaagtcagcctggcgccactaccagacc
atccaggaggccggcgactggtgtgtgcccagcacggagcccaagaacacgtccacgtac
cgcgtcagctaa

DBGET integrated database retrieval system