KEGG   Pan troglodytes (chimpanzee): 468536Help
Entry
468536            CDS       T01005                                 

Gene name
MAPK4
Definition
mitogen-activated protein kinase 4
Orthology
K06855  
mitogen-activated protein kinase 4/6 [EC:2.7.11.24]
Organism
ptr  Pan troglodytes (chimpanzee)
Brite
Enzymes [BR:ptr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     468536 (MAPK4)
Protein kinases [BR:ptr01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   468536 (MAPK4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
18
AA seq 587 aa AA seqDB search
MAEKGDCIASVYGYDLGGRFVDFQPLGFGVNGLVLSAVDSRACRKVAVKKIALSDARSMK
HALREIKIIRRLDHDNIVKVYEVLGPKGTDLRGELFKFSVAYIVQEYMETDLARLLEQGT
LAEEHAKLFMYQLLRGLKYIHSANVLHRDLKPANIFISTEDLVLKIGDFGXARIVDQHYS
HKGYLSEGLVTKWYRSPRLLLSPNNYTKAIDMWAAGCILAEMLTGRMLFAGAHELEQMQL
ILETIPVIREEDKDELLRVMPSFVSSTWEVKRPLRKLLPEVNSEAIDFLEKILTFNPMDR
LTAEMGLQHPYMSPYSCPEDEPTSQHPFRIEDEIDDIVLMAANQSQLSNWDTCSSRYPVS
LSSDLEWRPDRCQDASEVQRDPRAGSAPLAEDVQVDPRKDSHSSSERFLEQSHSSMERAF
EADYGRSCDYKVGSPSYLDKLLWRDNKPHHYSEPKLILDLSHWKQAAGAPPTATGLADTG
AREDEPASLFLEIAQWVKSTQGGPEHASPPADDPERRLSASPPGRPAPVDGGASPQFDLD
VFISRALKLCTKPEDLPDNKLGDLNGACIPEHPGDLVQTEAFSKERW
NT seq 1764 nt NT seq  +upstreamnt  +downstreamnt
atggctgagaagggtgactgcatcgccagtgtctatgggtatgacctcggtgggcgcttt
gttgacttccaacccctgggcttcggtgtcaatggtttggtgctgtcggccgtggacagc
cgggcctgccggaaggtcgctgtgaagaagattgccctgagcgatgcccgcagcatgaag
catgcgctccgagagatcaagatcattcggcgcctggaccacgacaacatcgtcaaagtg
tacgaggtgctcggtcccaagggcactgacctgcgcggtgagctgttcaagttcagcgtg
gcctacatcgtccaggagtacatggagaccgacctggcacgcctgctggagcagggcacg
ctggcagaagagcatgccaagctgttcatgtaccagctgctccgcgggctcaagtacatc
cactccgccaacgtgctgcacagggacctgaagcccgccaacatcttcatcagcacagag
gacctcgtgctcaagattggggatttcgggntggcaaggatcgttgatcagcattactcc
cacaagggttatctgtcagaagggttggtaacaaagtggtaccgttccccacgactgctc
ctttcccccaataactacaccaaagccatcgacatgtgggctgccggctgcatcctggct
gagatgcttacggggagaatgctctttgctggggcgcatgagctggagcagatgcaactc
atcctggagaccatccctgtaatccgggaggaagacaaggacgagctgctcagggtgatg
ccttcctttgtcagcagcacctgggaggtgaagaggcctctgcgcaagctgctccccgaa
gtgaacagtgaagccatcgactttctggagaagatcctgacctttaaccccatggatcgc
ctaacagctgagatggggctgcaacacccctacatgagcccatactcgtgccctgaggac
gagcccacctcgcaacaccccttccgcattgaggatgagatcgacgacatcgtgctgatg
gccgctaaccagagccagctgtccaactgggacacgtgcagttccaggtaccctgtgagc
ctgtcgtcggacctggagtggcggcctgaccggtgccaggacgccagcgaggtacagcgc
gacccgcgcgcgggttcggcgcccctggctgaggacgtgcaggtggacccgcgcaaggac
tcgcacagcagctccgagcgcttcctagagcagtcgcactcgtccatggagcgcgccttc
gaggccgactacgggcgctcctgcgactacaaggtggggtcgccgtcctacctggacaag
ctgctgtggcgcgacaacaagccgcaccactactcggagcccaagctcatcctggacctg
tcgcactggaagcaggcggccggcgcgccccccacggccacggggctggcggacacgggg
gcgcgcgaggacgagccggccagcctcttcctggagatcgcgcagtgggtcaagagcacg
cagggcggcccagagcacgccagcccgcccgccgacgaccccgagcgccgcttgtctgcc
tcgccccctggccgcccggccccggtggacggcggcgccagcccccagttcgacctggac
gtgttcatctcccgcgccctgaagctctgcaccaagcccgaggacctgccggacaataaa
ctgggcgacctcaatggtgcgtgcatccccgagcaccctggcgacctcgtgcagaccgag
gccttctccaaagaaaggtggtga

DBGET integrated database retrieval system