KEGG   Pan troglodytes (chimpanzee): 468943Help
Entry
468943            CDS       T01005                                 

Gene name
SPHK2
Definition
(RefSeq) sphingosine kinase 2
  KO
K04718  
sphingosine kinase [EC:2.7.1.91]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
Sphingolipid metabolism
Metabolic pathways
Calcium signaling pathway
Sphingolipid signaling pathway
VEGF signaling pathway
Fc gamma R-mediated phagocytosis
Tuberculosis
Module
Sphingosine degradation
Brite
KEGG Orthology (KO) [BR:ptr00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    468943 (SPHK2)
 Environmental Information Processing
  Signal transduction
   04370 VEGF signaling pathway
    468943 (SPHK2)
   04020 Calcium signaling pathway
    468943 (SPHK2)
   04071 Sphingolipid signaling pathway
    468943 (SPHK2)
 Organismal Systems
  Immune system
   04666 Fc gamma R-mediated phagocytosis
    468943 (SPHK2)
 Human Diseases
  Infectious diseases
   05152 Tuberculosis
    468943 (SPHK2)
Enzymes [BR:ptr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.91  sphingosine kinase
     468943 (SPHK2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
19
AA seq 353 aa AA seqDB search
MIGCLHARVSGPLWDAGLCPASSRSAHTCLSLSVSDAPVSPATAPHCLLLSTAPAPPCPC
HGVLNSHPFSPPFPQRPDQELTGSWGHGPRSTLVRAKAMAPPPPPLAASTPLLHGEFGSY
PAQGPRFALTLTSQALHIQRLRPKPEARPRGGLVPLAEVSGCCTLRSRSPSDSAAYFCIY
TYPRGRRGARRRATRTFRADGAATYEENRAEAQRWATALTCLLRGLPLPGDGEITPDLLP
RPPRLLLLVNPFGGRGLAWQWCKNHVLPMISEAGLSFNLIQTERQNHARELVQGLSLSEW
DGIVTVSGDGLLHEVLNGLLDRPDWEEAVKMPVGILPCGSGNALAGAVNQHGG
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atgattggatgtttgcatgcccgggtctccggccccctctgggatgctggcctctgtccc
gcatcctcaaggtctgcccacacctgtctgagcctgtctgtctctgatgctcctgtctca
cctgccactgcccctcattgtctcctcctgtccacagcccctgcccctccctgcccctgc
catggggtcctgaattctcaccccttctctcctcccttcccacagaggccagaccaggag
ctgaccgggagctggggccacgggcctaggagcaccctggtcagggctaaggccatggcc
ccgcccccaccgccactggctgccagcaccccgctcctccatggcgagtttggctcctac
ccagcccaaggcccacgctttgccctcacccttacatcgcaggccctgcacatacagcgg
ctgcgccccaaacctgaagccaggccccggggtggcctggtcccgttggccgaggtctca
ggctgctgcaccctgcgaagccgcagcccctcagactcagcggcctacttctgcatctac
acctaccctcggggccggcgcggggcccggcgcagagccactcgcaccttccgggcagat
ggggccgccacctacgaagagaaccgtgccgaggcccagcgctgggccactgccctcacc
tgtctgctccgaggactgccactgcccggggatggggagatcacccctgacctgctacct
cggccgccccggttgcttctattggtcaatccctttggggggcggggcctggcctggcag
tggtgtaagaaccacgtgcttcccatgatctctgaagctgggctgtccttcaacctcatc
cagacagaacgacagaaccacgcccgggagctggtccaggggctgagcctgagtgagtgg
gatggcatcgtcacggtctcgggagacgggctgctccatgaggtgctgaacgggctccta
gatcgccctgactgggaggaagctgtgaagatgcctgtgggcatcctcccctgcggctcg
ggcaacgcgctggccggggcagtgaaccagcacggggggtag

DBGET integrated database retrieval system