KEGG   Pan troglodytes (chimpanzee): 468943Help
Entry
468943            CDS       T01005                                 

Gene name
SPHK2
Definition
sphingosine kinase 2
Orthology
K04718  
sphingosine kinase [EC:2.7.1.91]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
Sphingolipid metabolism
Metabolic pathways
Calcium signaling pathway
VEGF signaling pathway
Fc gamma R-mediated phagocytosis
Tuberculosis
Module
Sphingosine degradation
Class
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:ptr00600]
Environmental Information Processing; Signal transduction; VEGF signaling pathway [PATH:ptr04370]
Environmental Information Processing; Signal transduction; Calcium signaling pathway [PATH:ptr04020]
Organismal Systems; Immune system; Fc gamma R-mediated phagocytosis [PATH:ptr04666]
Human Diseases; Infectious diseases; Tuberculosis [PATH:ptr05152]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
19
AA seq 625 aa AA seqDB search
MNGHLETEEQQDQRPDQELTGSWGHGPRSTLVRAKAMAPPPPPLAASTPLLHGEFGSYPA
QGPRFALTLTSQALHIQRLRPKPEARPRGGLVPLAEVSGCCTLRSRSPSDSAAYFCIYTY
PRGRRGARRRATRTFRADGAATYEENRAEAQRWATALTCLLRGLPLPGDGEITPDLLPRP
PRLLLLVNPFGGRGLAWQWCKNHVLPMISEAGLSFNLIQTERQNHARELVQGLSLSEWDG
IVTVSGDGLLHEVLNGLLDRPDWEEAVKMPVGILPCGSGNALAGAVNQHGGFEPALGLDL
LLNCSLLLCRGGGHPLDLLSVTLASGSRCFSFLSVAWGFVSDVDIQSERFRALGSARFTL
GTVLGLATLHTYRGRLSYLPATVEPASPTPAHSLPRAKSELTLTPDPAPPMAHSPLHRSV
SDLPSWLRNVRGCGCSVSRTHCIVTPGSPKAALHSPVSEGAPVIPPSSGLPLPTPDARVG
ASTCGPPDHLLPPLGTPLPPDWVTLEGDFVLMLAISPSHLGADLVAAPHARFDDGLVHLC
WVRSGISRAALLRLFLAMERGSHFSLGCPQLGYAAARAFRLEPLTPRGVLTVDGEQVEYG
PLQAQMHPGIGTLLTGPPGCPGREP
NT seq 1878 nt NT seq  +upstreamnt  +downstreamnt
atgaatggacaccttgaaacagaggagcagcaggaccagaggccagaccaggagctgacc
gggagctggggccacgggcctaggagcaccctggtcagggctaaggccatggccccgccc
ccaccgccactggctgccagcaccccgctcctccatggcgagtttggctcctacccagcc
caaggcccacgctttgccctcacccttacatcgcaggccctgcacatacagcggctgcgc
cccaaacctgaagccaggccccggggtggcctggtcccgttggccgaggtctcaggctgc
tgcaccctgcgaagccgcagcccctcagactcagcggcctacttctgcatctacacctac
cctcggggccggcgcggggcccggcgcagagccactcgcaccttccgggcagatggggcc
gccacctacgaagagaaccgtgccgaggcccagcgctgggccactgccctcacctgtctg
ctccgaggactgccactgcccggggatggggagatcacccctgacctgctacctcggccg
ccccggttgcttctattggtcaatccctttggggggcggggcctggcctggcagtggtgt
aagaaccacgtgcttcccatgatctctgaagctgggctgtccttcaacctcatccagaca
gaacgacagaaccacgcccgggagctggtccaggggctgagcctgagtgagtgggatggc
atcgtcacggtctcgggagacgggctgctccatgaggtgctgaacgggctcctagatcgc
cctgactgggaggaagctgtgaagatgcctgtgggcatcctcccctgcggctcgggcaac
gcgctggccggagcagtgaaccagcacgggggatttgagccagccctgggcctcgacctg
ttgctcaactgctcactgttgctgtgccggggtggtggccacccactggacctgctctcc
gtgacgctggcctcgggctcccgctgtttctccttcctgtctgtggcctggggcttcgtg
tcagatgtggatatccagagcgagcgcttcagggccttgggcagtgcccgcttcacactg
ggcacggtgctgggcctcgccacactgcacacctaccgcggacgcctctcctacctcccc
gccactgtggaacccgcctcgcccacccctgcccatagcctgcctcgtgccaagtcggag
ctgaccctaaccccagacccagccccgcccatggcccactcacccctgcatcgttctgtg
tctgacctgcctagctggctgaggaatgtgaggggatgtggatgctctgtgtctcggacg
cactgtatcgtcactcctggctctcccaaggcagctctacactcacccgtctccgaaggg
gcccccgtaattcccccatcctctgggctcccacttcccacccctgatgcccgggtaggg
gcctccacctgcggcccgcccgaccacctgctgcctccgctgggcaccccgctgccccca
gactgggtgacgctggagggggactttgtgctcatgttggccatctcgcccagccaccta
ggcgctgacctggtggcagctccgcatgcgcgcttcgacgacggcctggtgcacctgtgc
tgggtgcgtagcggcatctcgcgggctgcgctgctgcgccttttcttggccatggagcgt
ggtagccacttcagcctgggctgtccgcagctgggctacgccgcggcccgtgccttccgc
ctagagccgctcacaccacgcggcgtgctcacagtggacggggagcaggtggagtatggg
ccgctacaggcacagatgcaccctggcatcggtacactgctcactgggcctcccggctgc
ccggggcgggagccctga

DBGET integrated database retrieval system