KEGG   Pan troglodytes (chimpanzee): 469031Help
Entry
469031            CDS       T01005                                 

Gene name
USP29
Definition
ubiquitin specific peptidase 29
Orthology
K11850  
ubiquitin carboxyl-terminal hydrolase 26/29/37 [EC:3.1.2.15]
Organism
ptr  Pan troglodytes (chimpanzee)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
19
AA seq 922 aa AA seqDB search
MISLKLRGFIQIWSQKTGMTKLKEALIETVQRQKEIKLVVTFKSGKFIGIFQLSNNIRSV
VLRHCKKRQSHLRLTLKNNVFLFIDKLSYRDAKQLNMFLDIIHQNKSQQLMKSDDDWSVF
ESRNMLKEIDKTSFYSICNKPSYQKMPLFMSKSPTHVKKGILENQGGKGQNTLSSDLQTN
EDILKEYNPVPNKKYKTDSLKYIQSNRKNPSSLEDLEKDRDLKLGPSFNTNCNGNPNLDE
TVLATQTLNAKNGLTSPLEPEHSQGDPRCNKAQVPLDSHSQQLQQGFPNLGNTCYMNAIL
QSLFAIPSFADDLLTQGVPWEYIPFEALIMTLTQLLALKDFCSTKIKRELLGNVKKVISA
VAEIFSGSMQNDAHEFLGQCLDQLKEDMEKLNAILNTGKECGDENSSPQMHVGSAATKVF
VCPVVANFEFELQLSLICKACGHAVLKVEPNNYLSINLHQETKPLPLSIQNSLDLFFKEE
ELEYNCEMCKQKSCVARHTFSRLSRVLIIHLKRYSFNNSWLLVKNNEQVYIPKSLSLSSY
CNESTKPPLPLSSSAPVGKCEVLEVSQELISKITSPLTPSMKLTSESSDSLVLPIEPDKN
ADLQRFQRDCGDASQEQHQRDLENGSALESELVHFRDRAIGEKELPVADSLMDQGDISLP
VMYEDGGKLISSPDTRLVEVHLQEVPQHPELQKYEKTNTFVEFNFDSVTESTNGFYDCKE
NRIPEGSQGMAEQLQQCIEESIIEEFLQQAPPPGVRKLDAQEHTEEILNQSTELRLPKAD
LNHLGALGSDNPGNKNILDAENTRGEAKELTRNVKMGDPLQAYRLISVVSHIGSSPNSGH
YISDVYDFQKQAWFTYNDLCVSEISETKMQEARLHSGYIFFYMHNGIFEELLRKAENSRL
PSTQAGVIPQGEXEGDSLYRPA
NT seq 2769 nt NT seq  +upstreamnt  +downstreamnt
atgatatctctaaagttacgtggattcatccaaatttggagtcagaagactgggatgact
aagctgaaagaagctctcattgaaacagtgcagagacaaaaggaaattaaactggtggtc
actttcaaatctggaaaatttataggaatttttcagctgagcaacaacattagaagtgtg
gtccttagacattgtaaaaaaagacaaagtcacctgcgtttaactttgaaaaacaacgtg
ttcttgtttattgacaaattatcctacagagatgctaaacagttgaatatgtttctggac
ataatccaccaaaacaaatctcagcaactcatgaaatctgatgatgattggagtgtgttt
gaaagcaggaatatgctgaaggaaattgacaaaacttcattttacagcatttgtaacaag
ccaagttatcagaagatgcctttgtttatgtcgaaatcaccaacacatgtgaaaaagggg
atattagaaaatcaaggtgggaaggggcaaaacacgctatcttctgatctgcagacaaat
gaggacattctgaaggaatataaccctgtaccaaacaagaaatataagacagattccttg
aaatatatacaaagcaataggaagaacccatcaagtttagaggatttagaaaaagataga
gatttgaaactcgggccttcattcaataccaactgtaatggaaatcctaacctagatgag
actgttcttgcaacccagactctcaatgccaaaaatggtttgacatctccattggaacca
gagcacagccagggtgacccgagatgcaacaaagcccaggtgcctcttgactctcattca
cagcaactgcagcaggggttccccaatttgggaaacacctgttacatgaatgcaatttta
caatcgctatttgcaattccatcttttgctgatgacttactcactcaaggtgtcccatgg
gaatatattccctttgaggctcttattatgaccttgacccagctgcttgctttgaaagat
ttctgtagtacaaagatcaagagagaattacttgggaatgttaaaaaagtcatttcagca
gttgcagaaatattttctggcagcatgcagaatgatgctcatgagtttttaggtcagtgt
ttagaccagctgaaagaagacatggaaaagttaaatgccattttgaatactgggaaagaa
tgtggggatgaaaattcatctccacaaatgcatgttggtagtgctgccaccaaagtgttt
gtttgccctgttgttgctaattttgagtttgaattgcagctctcccttatttgtaaagct
tgtggtcatgctgttctcaaggtagaacctaataattatctctccatcaacctgcaccaa
gaaacaaaaccacttcctttgtccattcagaattctttagatcttttctttaaagaagaa
gagcttgaatataactgtgagatgtgtaagcagaagagttgcgttgcaaggcatacattt
agtaggctctccagggtccttatcattcatctgaaacgctatagcttcaacaattcttgg
ttgctggtgaagaataacgagcaagtttatattcccaaatctttaagtttatcttcttat
tgcaatgaaagcaccaaaccacctcttcccttgagcagtagtgcacctgttgggaaatgt
gaagtcctggaagtctctcaggagttgatttctaagatcaccagcccattgacaccatca
atgaagctgacctcagaatccagtgattccctggttctacccattgaaccagacaagaat
gccgacctacaaagattccagagagactgtggagatgcaagccaagagcagcatcagaga
gacctggaaaatggctctgcactagagtcagaattggtccactttagagacagggcaatc
ggtgaaaaggagcttccagtggctgactcactgatggaccagggagacatttctcttcct
gtgatgtatgaagatggagggaagctgatcagcagcccagacacaaggcttgtcgaggtt
catcttcaagaggtgcctcaacatccagaacttcagaagtatgagaaaaccaatacattc
gtagagttcaattttgacagtgtcactgagtccaccaatggcttttatgactgtaaagaa
aacaggattccagaaggatctcaaggaatggctgaacagctccagcagtgtattgaggag
agcatcatagaggaatttcttcagcaggcaccacctccaggtgttaggaagctggatgcc
caggaacatacagaagagatcctcaatcagtctacagaattaagacttccaaaggctgac
ctgaatcaccttggggcactgggttctgacaacccaggaaacaaaaacattttagatgca
gagaacacaagaggtgaagccaaggaactaacaagaaacgtgaagatgggggatcctctc
caggcctacagactcatcagtgttgtcagccatatcgggagctccccaaattcaggccat
tacatcagcgatgtgtatgactttcagaagcaggcctggttcacatacaacgatctatgt
gtatcagaaatctcagagaccaaaatgcaggaggcgaggcttcactctgggtatatcttc
ttttacatgcacaatgggatttttgaggagctgttaagaaaagcagagaactctcggcta
cctagcacacaggcaggggtgatccctcagggggaataagaaggtgactctttgtacaga
cctgcttga

DBGET integrated database retrieval system