KEGG   Pan troglodytes (chimpanzee): 469130Help
Entry
469130            CDS       T01005                                 

Gene name
AGMAT
Definition
agmatine ureohydrolase (agmatinase)
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
Arginine and proline metabolism
Metabolic pathways
Module
Polyamine biosynthesis, arginine => agmatine => putrescine => spermidine
Brite
KEGG Orthology (KO) [BR:ptr00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    469130 (AGMAT)
Enzymes [BR:ptr01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     469130 (AGMAT)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
1
AA seq 352 aa AA seqDB search
MLRLLASGCARGPGPGVGARPAAGLFHPGRRQSRQASDAPRNQPPSPEFVARPVGVCSMM
RLPVQTSPEGLDAAFIGVPLDTGTSNRPGARFGPRRIREESVMLRTVNPSTGALPFQSLM
VADLGDVNVNLYNLQDSCRRIQEAYEKIVAAGCIPLTLGGDHTITYPILQAMAKKHGPVG
LLHVDAHTDTTDKALGEKLYHGAPFRRCVDEGLLDCKRVVQIGIRGSSTTLDPYRYNWSQ
GFRVVLAEDCWMKSLVPLMGEVRQQMGGKPIYISFDIDALDPAYAPGTGTPEIAGLTPSQ
ALEIIRGCQGLNVVGCDLVEVSPPYDLSGNTALLAANLLFEMLCALPKVTTV
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgctgaggctgctggcgtccgggtgcgcccggggcccggggcccggcgtgggcgcgcgt
cctgccgcagggctctttcacccggggcgccgccagagccgccaggcttccgacgcgccc
cggaaccagccccccagccccgagttcgtggcccggccggtgggcgtctgctccatgatg
cgcctgccggtgcagacctcccccgaggggctggacgctgccttcatcggggtgcccctg
gatactgggacctccaaccggcctggggcgagattcggacctcgccgcatccgggaagaa
tcagtgatgcttcggacagtcaatcctagcacgggggccctccccttccagtccctcatg
gttgcagacctaggcgatgtgaatgtcaatctttacaaccttcaggacagctgccggcga
attcaagaggcctatgagaaaattgtagcagctggctgtattcctctgaccttgggtgga
gatcacacaatcacatatcccatattgcaagcgatggcaaaaaagcatggcccagtgggg
ctgctgcatgtggacgcacacacggacacgaccgacaaggccctaggagagaagctctac
cacggggcgcccttccgccggtgtgtggatgagggtctcctggactgtaagcgtgtggtg
cagattggcatccggggctcttccacgaccttggatccctacagatacaactggagccag
ggcttccgggtagtcctggctgaagactgctggatgaagtcgttggttcctctgatgggg
gaagtcaggcagcagatgggaggcaaacccatttatatcagctttgatattgacgctctg
gatcctgcctatgcgccagggacagggacacctgaaattgctggtctcactcctagtcag
gctctggagatcatcaggggttgtcaaggcctgaacgtggtgggctgtgatcttgtcgaa
gtttcaccaccgtatgatctttctgggaacacagccctgctggcggctaacctgctgttt
gagatgctgtgtgctctccccaaagtgacaaccgtctga

DBGET integrated database retrieval system