KEGG   Pan troglodytes (chimpanzee): 469179Help
Entry
469179            CDS       T01005                                 

Gene name
PADI6
Definition
(RefSeq) peptidyl arginine deiminase 6
  KO
K01481  
protein-arginine deiminase [EC:3.5.3.15]
Organism
ptr  Pan troglodytes (chimpanzee)
Brite
Enzymes [BR:ptr01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.15  protein-arginine deiminase
     469179 (PADI6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
1
AA seq 692 aa AA seqDB search
MVSVEGRAMSFQSIVHLSLDSPVHAVCVLGTEICLDLSGCAPQKCQCFTIHGSGRVLIDV
ANTVISEKEDATIWWPLSDPTYATVKMTSPSPSMDADKVSVTYYGPNEDAPVGTAVLYLT
GIEVSLEVDIYRNGQVEMSSDKQAKKKWIWGPSGWGAILLVNCNPADVGQQLEDKKTKKV
IFSEEITNLSQMTLNVQGPSCILTKYRLVLHTSKEESKKARVYWPQNNSSTFELVLGPDQ
HAYTLALGNHLKETFYVEAIAFPSAEFSGLISYSVSLVEESQDPSIPETVLYKDTVVFRV
APCVFIPCTQVPLEVYLCRELQLQGFVDTVTKLSEKSNSQVASVYEDPNRLGRWLQDEMA
FCYTQAPHKTTSLILDTPQAADLDEFPMKYSLSPGIGYMIQDTEDHKVASMDSIGNLMVS
PPVKVEGKEYPLGRVLIGSSFYPSAEGRAMSKTLRDFLYAQQVQAPVELYSDWLMTGHVD
EFMCFIPTDDKNEGKKGFLLLLASPSACYKLFREKQKEGYGDALLFDELRADQLLSNGRE
AKTIDQLLADESLKKQNEYVEKCIHLNRDILKTELGLVEQDIIEIPQLFCLEKLTNIPSD
QQPKRSFARPYFPDLLRMIVMGKNLGIPKPFGPQIKGTCCLEEKICCLLEPLGFKCTFIN
DFDCYLTEVGDICACANIRRVPFAFKWWKMVP
NT seq 2079 nt NT seq  +upstreamnt  +downstreamnt
atggtcagcgtggagggccgagccatgtccttccagagtatcgtccacctgtccctggac
agccctgtccatgccgtttgtgtgttgggcacagaaatctgcttggatctcagcgggtgt
gccccccagaagtgccagtgcttcaccatccatggctctgggagggtcttgatcgatgtg
gccaacacagtgatttctgagaaggaggacgccaccatctggtggcccctgtctgatccc
acgtacgccacagtgaagatgacatcgcccagcccttccatggatgcggataaggtctcg
gtcacatactatgggcccaacgaggatgcccccgtgggcacagctgtgctgtacctcact
ggcattgaggtctctctagaggtagacatctaccgcaatgggcaagttgagatgtcaagt
gacaaacaggctaagaaaaaatggatctggggtcccagcggttggggtgccatcctgctt
gtgaattgcaaccctgctgatgtgggccagcaacttgaggacaagaaaaccaagaaagtg
atcttttcagaggaaataacgaatctgtcccagatgactctgaatgtccaaggccccagc
tgtatcttaacgaaatatcggctagtcctccatacctccaaggaagagtcgaagaaggcg
agagtctactggccccaaaacaactccagtacctttgagttggtgctggggcccgaccag
cacgcctataccttggccctcgggaaccacttgaaggagactttctatgttgaagctata
gcattcccgtctgccgaattctcaggcctcatctcctactctgtgtccctggtggaggag
tctcaagacccgtcaattccagagactgtgctgtacaaagacacggtggtgttccgggtg
gctccctgcgtcttcattccctgtacccaggtgcctctggaggtttacctgtgcagggag
ctgcagctgcagggttttgtggacacggtgacgaagctgagtgagaagagcaacagccag
gtggcatctgtctatgaggaccccaaccgcctgggcaggtggctccaggatgagatggcc
ttctgctacacccaggctccccacaagacaacgtccttgatcctcgacacacctcaggcc
gccgatctcgatgagttccccatgaagtactcactgagccctggtattggctacatgatc
caggacactgaggaccataaagtggccagcatggattccattgggaacctgatggtgtcc
ccacctgtcaaggtcgaagggaaagagtacccgctgggcagagtcctcattggcagcagc
ttttaccccagcgcagagggccgggccatgagtaagaccctccgagacttcctctatgcc
cagcaggtccaagcgccggtggagctctactcagattggctaatgactggccacgtggat
gagttcatgtgcttcatccccacagatgacaagaatgagggcaaaaagggcttcctgctg
ctcctggccagccccagtgcctgctataaactgttccgagagaaacagaaggaaggctat
ggcgacgctcttctgtttgatgagcttagagcagatcagctcctgtctaatggaagggaa
gccaaaaccatcgaccaacttctggctgatgaaagcctgaagaagcagaatgaatacgtg
gagaagtgcattcacctgaaccgtgacatcctgaagacggagctgggcctggtggaacag
gacatcattgagattccccagctgttctgcttggagaagctgactaacatcccctctgac
cagcagcccaagaggtccttcgcgaggccatacttccctgacctgttgcggatgattgtg
atgggcaagaacctggggatccccaagccttttgggccccaaatcaaggggacttgctgc
ctggaagaaaagatttgctgcttgctggagcccctgggcttcaagtgcaccttcatcaat
gactttgactgttacctgacagaggtcggagacatctgtgcctgtgccaacatccgccgg
gtgccctttgccttcaaatggtggaagatggtaccttag

DBGET integrated database retrieval system