KEGG   Pan troglodytes (chimpanzee): 469181Help
Entry
469181            CDS       T01005                                 

Gene name
TESK2
Definition
testis-specific kinase 2
Orthology
K08842  
testis-specific kinase 2 [EC:2.7.12.1]
Organism
ptr  Pan troglodytes (chimpanzee)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 571 aa AA seqDB search
MDRSKRNSIAGFPPRVERLEEFEGGGGGEGNVSQVGRVWPSSYRALISAFSRLTRLDDFT
CEKIGSGFFSEVFKVRHRASGQVMALKMNTLNSNRANMLKEVQLMNRLSHPNILRFMGVC
VHQGQLHALTEYINSGNLEQLLDSNLHLPWTVRVKLAYDIAVGLSYLHFKGIFHRDLTSK
NCLIKRDENGYSAVVADFGLAEKIPDVSMGSEKLAVVGSPFWMAPEVLRDEPYNEKADVF
SYGIILCEIIARIQADPDYLPRTENFGLDYDAFQHMVGDCPPDFLQLTFNCCNMDPKLRP
SFVEIGKTLEEILSRLQEEEQERDRKLQPTARGLLEKAPGVKRLSSLDDKIPHKSPCPRR
TIWLSRSQSDIFSRKPPRTVSVLDPYYRPRDGAARTPKVNPFSARQDLMGGKIKFFDLPS
KSVISLVFDLDAPGPGTMPLADWQEPLAPPIRRWRSLPGSPEFLHQEACPFVGREESLSD
GPPPRLSSLKYRVKEIPPFRASALPAAQAHEAMDCSILQEENGFGSRPQGTSPCPAGASE
EMEVEERPAGSTPATFSTSGIGLQTQGKQDG
NT seq 1716 nt NT seq  +upstreamnt  +downstreamnt
atggatcggagcaaacggaattcaattgcaggatttcctccacgtgtggagcgtcttgaa
gagtttgaaggaggtggtggaggagaaggaaatgtgagccaggtgggaagagtttggcca
tcttcgtatcgagctcttataagtgccttttccagactgacacgtttggatgatttcacc
tgtgaaaaaatagggtctggcttcttttctgaagtgttcaaggtacgacaccgagcttct
ggtcaggtgatggctcttaagatgaacacgttgaacagtaaccgggcaaacatgctgaaa
gaagtacagctcatgaatagactctcccatcccaacatccttaggttcatgggtgtatgt
gttcatcaaggacaactgcatgcacttacagagtatatcaactccgggaacctggaacag
ttgctagacagtaacctgcatttgccttggactgtgagggtaaaactggcctatgacata
gcagtgggcctcagctaccttcacttcaaaggcatttttcatcgggacctcacatctaag
aactgcctgataaagagggatgagaatggttactctgcagtggtagctgactttggcctg
gctgagaagatccccgatgtcagcatggggagtgagaagctggccgtggtgggttcccca
ttctggatggcacctgaggttctccgagatgagccctataatgaaaaggcagatgtgttc
tcttatggtatcatcctctgcgagatcatcgcccgcatccaggccgatccggactatctt
ccccgcacagagaatttcgggctggactatgatgctttccagcacatggtgggagactgt
cccccagattttctgcaacttactttcaactgctgtaacatggaccccaaactgcgccca
tcttttgtggagattgggaagaccctggaggaaattctgagccgcctacaggaagaagag
caggagagggataggaagctgcagcccacagccaggggactcttggagaaagcacctggg
gtgaagcgactaagctcactggatgacaagatcccccacaagtcaccatgcccaagacgt
accatctggctgtctcgaagccagtcagatatcttttcccgtaagcccccacgtacagtg
agtgtcttggacccatactacaggccacgagatggtgctgcccgcacccccaaagtcaac
ccttttagtgctcgccaggacctcatggggggcaagatcaagttttttgacctgcccagc
aagtctgtcatctctctggtatttgacctggatgcaccagggcccggaactatgcccctg
gctgactggcaggagcccctggccccacctattcgccggtggcgttccttgcctggttcg
cctgagttcttgcatcaagaggcttgtccatttgtgggccgggaagaatcgctatctgat
gggcccccaccacgcctaagtagtctcaagtacagagttaaagagatcccaccattccgg
gcatctgccctaccagctgctcaagcccatgaggctatggactgctccattctccaggaa
gaaaatggttttgggtccaggccccaggggaccagtccatgccctgcgggtgcttctgag
gagatggaggtagaagaaaggccagcaggctcaactccagccaccttctccacctcaggc
ataggcctgcaaacccagggaaagcaggatgggtga

DBGET integrated database retrieval system