KEGG   Pan troglodytes (chimpanzee): 469651Help
Entry
469651            CDS       T01005                                 

Gene name
REN
Definition
renin (EC:3.4.23.15)
Orthology
K01380  
renin [EC:3.4.23.15]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
Renin-angiotensin system
Brite
KEGG Orthology (KO) [BR:ptr00001]
 Organismal Systems
  Endocrine system
   04614 Renin-angiotensin system
    469651 (REN)
Enzymes [BR:ptr01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.23  Aspartic endopeptidases
    3.4.23.15  renin
     469651 (REN)
Peptidases [BR:ptr01002]
 Aspartic Peptidases
  Family A1: pepsin family
   469651 (REN)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
1
AA seq 406 aa AA seqDB search
MDGWRRMPRWGLLLLLWGSCTFGLPTDTTTFKRIFLKRMPSIRESLKERGVDMARLGPEW
SQPMKRLTLGNTTSSVILTNYMDTQYYGEIGIGTPPQTFKVVFDTGSSNVWVPSSKCSRL
YTACVYHKLFDASDSSSYKHNGTELTLRYSTGTVSGFLSQDIITVGGITVTQMFGEVTEM
PALPFMLAEFDGVVGMGFIEQAIGRVTPIFDNIISQGVLKEDVFSFYYNRDSENSQSLGG
QIVLGGSDPQHYEGNFHYINLIKTGVWQIQMKGVSVGSSTLLCEDGCLALVDTGASYISG
STSSIEKLMEALGAKKRLFDYVVKCNEGPTLPDISFHLGGKEYTLTSADYVFQESYSSKK
LCTLAIHAMDIPPPTGPTWALGATFIRKFYTEFDRRNNRIGFALAR
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atggacggatggagaagaatgcctcgctggggactgctgctgctgctctggggctcctgt
acctttggtctcccgacagacaccaccacctttaaacggatcttcctcaagagaatgccc
tcaatccgagaaagcctgaaggaacgaggtgtggacatggccaggcttggtcccgagtgg
agccaacccatgaagaggctgacccttggcaacaccacctcctccgtgatcctcaccaac
tacatggacacccagtactatggcgagattggcatcggcaccccaccccagaccttcaaa
gtcgtctttgacactggttcgtccaatgtttgggtgccctcctccaagtgcagccgtctc
tacactgcctgtgtgtatcacaagctcttcgatgcttcggattcctccagctacaagcac
aatggaacagaactcaccctccgctattcaacagggacagtcagtggctttcttagccag
gacatcatcaccgtgggtggaatcacggtgacacagatgtttggagaggtcacggagatg
cccgccttacccttcatgctggccgagtttgatggggttgtgggcatgggcttcattgaa
caggccattggcagggtcacccctatcttcgacaacatcatctcccaaggggtgctaaaa
gaggacgtcttctctttctactacaacagagattccgagaattctcaatcgctgggagga
cagattgtgctgggaggcagcgacccccagcattacgaagggaatttccactatatcaac
ctcatcaagactggtgtctggcagattcaaatgaagggggtgtctgtggggtcatccacc
ttgctctgtgaagacggctgcctggcattggtggacaccggtgcatcctacatctcaggt
tctaccagctccatagagaagctcatggaggccttgggagccaagaagaggctgtttgat
tatgtcgtgaagtgtaacgagggccctacactccccgacatctctttccacctgggaggc
aaagaatacacgctcaccagcgcggactatgtatttcaggaatcctacagtagtaaaaag
ctgtgcacactggccatccacgccatggatatcccgccacccactggacccacctgggcc
ctgggggccaccttcatccgaaagttctacacagagtttgatcggcgtaacaaccgcatt
ggcttcgccttggcccgctga

DBGET integrated database retrieval system