KEGG   Pan troglodytes (chimpanzee): 469702Help
Entry
469702            CDS       T01005                                 

Gene name
HIST1H2BB, HIST1H2BD
Definition
histone cluster 1, H2bd
Orthology
K11252  
histone H2B
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
Alcoholism
Viral carcinogenesis
Systemic lupus erythematosus
Class
Human Diseases; Cancers; Viral carcinogenesis [PATH:ptr05203]
Human Diseases; Immune diseases; Systemic lupus erythematosus [PATH:ptr05322]
Human Diseases; Substance dependence; Alcoholism [PATH:ptr05034]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1
AA seq 126 aa AA seqDB search
MPEPSRAAPASKKGSKKAITKAQKKDGKKRKRGRKESYSIYVYKVLKQVHPDTGISSKAM
GIMNSFVNDIFERIASEASRLAHYNKRSTITSREMQTAVRLLLPGELAKHAVSERTKAVT
KYTSSK
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atgccggagccatcgcgggcggctccggcttctaaaaagggctccaagaaggccattacc
aaggcgcagaagaaggacggcaagaagcgcaagcgcggccgcaaggagagctattctatc
tacgtgtacaaggtgctgaagcaggtgcaccccgacaccggcatctcgtccaaggccatg
ggcatcatgaactccttcgtcaatgacatcttcgagcgcatcgccagcgaggcctcccgc
ctggcgcactacaacaagcgctccaccatcacgtcccgcgaaatgcagacggccgtgcgc
ctgctgctgcccggcgagctggccaagcacgccgtgtccgagcgcactaaggctgtcacc
aagtacaccagctccaagtga

DBGET integrated database retrieval system