KEGG   Pan troglodytes (chimpanzee): 469875Help
Entry
469875            CDS       T01005                                 

Gene name
PLCB1
Definition
(RefSeq) 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-1 isoform X2
  KO
K05858  phosphatidylinositol phospholipase C, beta [EC:3.1.4.11]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr00562  Inositol phosphate metabolism
ptr01100  Metabolic pathways
ptr04015  Rap1 signaling pathway
ptr04020  Calcium signaling pathway
ptr04022  cGMP-PKG signaling pathway
ptr04062  Chemokine signaling pathway
ptr04070  Phosphatidylinositol signaling system
ptr04071  Sphingolipid signaling pathway
ptr04072  Phospholipase D signaling pathway
ptr04261  Adrenergic signaling in cardiomyocytes
ptr04270  Vascular smooth muscle contraction
ptr04310  Wnt signaling pathway
ptr04371  Apelin signaling pathway
ptr04540  Gap junction
ptr04611  Platelet activation
ptr04621  NOD-like receptor signaling pathway
ptr04713  Circadian entrainment
ptr04720  Long-term potentiation
ptr04723  Retrograde endocannabinoid signaling
ptr04724  Glutamatergic synapse
ptr04725  Cholinergic synapse
ptr04726  Serotonergic synapse
ptr04728  Dopaminergic synapse
ptr04730  Long-term depression
ptr04750  Inflammatory mediator regulation of TRP channels
ptr04911  Insulin secretion
ptr04912  GnRH signaling pathway
ptr04915  Estrogen signaling pathway
ptr04916  Melanogenesis
ptr04918  Thyroid hormone synthesis
ptr04919  Thyroid hormone signaling pathway
ptr04921  Oxytocin signaling pathway
ptr04922  Glucagon signaling pathway
ptr04924  Renin secretion
ptr04925  Aldosterone synthesis and secretion
ptr04926  Relaxin signaling pathway
ptr04927  Cortisol synthesis and secretion
ptr04928  Parathyroid hormone synthesis, secretion and action
ptr04933  AGE-RAGE signaling pathway in diabetic complications
ptr04934  Cushing's syndrome
ptr04961  Endocrine and other factor-regulated calcium reabsorption
ptr04970  Salivary secretion
ptr04971  Gastric acid secretion
ptr04972  Pancreatic secretion
ptr05010  Alzheimer's disease
ptr05016  Huntington's disease
ptr05142  Chagas disease (American trypanosomiasis)
ptr05143  African trypanosomiasis
ptr05146  Amoebiasis
ptr05200  Pathways in cancer
Module
ptr_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:ptr00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    469875 (PLCB1)
 Environmental Information Processing
  Signal transduction
   04015 Rap1 signaling pathway
    469875 (PLCB1)
   04310 Wnt signaling pathway
    469875 (PLCB1)
   04371 Apelin signaling pathway
    469875 (PLCB1)
   04020 Calcium signaling pathway
    469875 (PLCB1)
   04070 Phosphatidylinositol signaling system
    469875 (PLCB1)
   04072 Phospholipase D signaling pathway
    469875 (PLCB1)
   04071 Sphingolipid signaling pathway
    469875 (PLCB1)
   04022 cGMP - PKG signaling pathway
    469875 (PLCB1)
 Cellular Processes
  Cellular community - eukaryotes
   04540 Gap junction
    469875 (PLCB1)
 Organismal Systems
  Immune system
   04611 Platelet activation
    469875 (PLCB1)
   04621 NOD-like receptor signaling pathway
    469875 (PLCB1)
   04062 Chemokine signaling pathway
    469875 (PLCB1)
  Endocrine system
   04911 Insulin secretion
    469875 (PLCB1)
   04922 Glucagon signaling pathway
    469875 (PLCB1)
   04912 GnRH signaling pathway
    469875 (PLCB1)
   04915 Estrogen signaling pathway
    469875 (PLCB1)
   04921 Oxytocin signaling pathway
    469875 (PLCB1)
   04926 Relaxin signaling pathway
    469875 (PLCB1)
   04918 Thyroid hormone synthesis
    469875 (PLCB1)
   04919 Thyroid hormone signaling pathway
    469875 (PLCB1)
   04928 Parathyroid hormone synthesis, secretion and action
    469875 (PLCB1)
   04916 Melanogenesis
    469875 (PLCB1)
   04924 Renin secretion
    469875 (PLCB1)
   04925 Aldosterone synthesis and secretion
    469875 (PLCB1)
   04927 Cortisol synthesis and secretion
    469875 (PLCB1)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    469875 (PLCB1)
   04270 Vascular smooth muscle contraction
    469875 (PLCB1)
  Digestive system
   04970 Salivary secretion
    469875 (PLCB1)
   04971 Gastric acid secretion
    469875 (PLCB1)
   04972 Pancreatic secretion
    469875 (PLCB1)
  Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    469875 (PLCB1)
  Nervous system
   04724 Glutamatergic synapse
    469875 (PLCB1)
   04725 Cholinergic synapse
    469875 (PLCB1)
   04728 Dopaminergic synapse
    469875 (PLCB1)
   04726 Serotonergic synapse
    469875 (PLCB1)
   04720 Long-term potentiation
    469875 (PLCB1)
   04730 Long-term depression
    469875 (PLCB1)
   04723 Retrograde endocannabinoid signaling
    469875 (PLCB1)
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    469875 (PLCB1)
  Environmental adaptation
   04713 Circadian entrainment
    469875 (PLCB1)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    469875 (PLCB1)
  Neurodegenerative diseases
   05010 Alzheimer's disease
    469875 (PLCB1)
   05016 Huntington's disease
    469875 (PLCB1)
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    469875 (PLCB1)
   04934 Cushing's syndrome
    469875 (PLCB1)
  Infectious diseases
   05146 Amoebiasis
    469875 (PLCB1)
   05142 Chagas disease (American trypanosomiasis)
    469875 (PLCB1)
   05143 African trypanosomiasis
    469875 (PLCB1)
Enzymes [BR:ptr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     469875 (PLCB1)
Membrane trafficking [BR:ptr04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    469875 (PLCB1)
 Endocytosis
  Macropinocytosis
   Phospholipase C
    469875 (PLCB1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PI-PLC-X PLC-beta_C PI-PLC-Y EF-hand_like DUF1154
Motif
Other DBs
NCBI-GeneID: 469875
NCBI-ProteinID: XP_009435050
Ensembl: ENSPTRG00000013241
UniProt: K7BA21
Position
20
AA seq 1216 aa AA seqDB search
MAGAQPGVHALQLKPVCVSDSLKKGTKFVKWDDDSTIVTPIILRTDPQGFFFYWTDQNKE
TELLDLSLVKDARCGRHAKAPKDPKLRELLDVGNIGRLEQRMITVVYGPDLVNISHLNLV
AFQEEVAKEWTNEVFSLATNLLAQNMSRDAFLEKAYTKLKLQVTPEGRIPLKNIYRLFSA
DRKRVETALEACSLPSSRNDSIPQEDFTPEVYRVFLNNLCPRPEIDNIFSEFGAKSKPYL
TVDQMMDFINLKQRDPRLNEILYPPLKQEQVQVLIEKYEPNNSLARKGQISVDGFMRYLS
GEENGVVSPEKLDLNEDMSQPLSHYFINSSHNTYLTAGQLAGNSSVEMYRQVLLSGCRCV
ELDCWKGRTAEEEPVITHGFTMTTEISFKEVIEAIAECAFKTSPFPILLSFENHVDSPKQ
QAKMAEYCRLIFGDALLMEPLEKYPLESGVPLPSPMDLMYKILVKNKKKSHKSSEGSGKK
KLSEQASNTYSDSSSMFEPSSPGAGEADTESDDDDDDDDCKKSSMDEGTAGSEAMATEEM
SNLVNYIQPVKFESFEISKKRNKSFEMSSFVETKGLEQLTKSPVEFVEYNKMQLSRIYPK
GTRVDSSNYMPQLFWNAGCQMVALNFQTMDLAMQINMGMYEYNGKSGYRLKPEFMRRPDK
HFDPFTEGIVDGIVANTLSVKIISGQFLSDKKVGTYVEVDMFGLPVDTRRKAFKTKTSQG
NAVNPVWEEEPIVFKKVVLPTLACLRIAVYEEGGKFIGHRILPVQAIRPGYHYICLRNER
NQPLTLPAVFVYIEVKDYVPDTYADVIEALSNPIRYVNLMEQRAKQLAALTLEDEEEVKK
EADPGETPSEAPSEARTTPAENGVNHTTTLTPKPPSQALHSQPAPGSVKAPAKTEDLIQS
VLTEVEAQTIEELKQQKSFVKLQKKHYKEMKDLVKRHHKKTTDLIKEHTTKYNEIQNDYL
RRRAALEKSAKKDSKKKSEPSSPDHGSSTIEQDLAALDAEMTQKLIDLKDKQQQQLLNLR
QEQYYSEKYQKREHIKLLIQKLTDVAEECQNNQLKKLKEICEKEKKELKKKMDKKRQEKI
TEAKSKDKSQMEEEKTEMIRSYIQEVVQYIKRLEEAQSKRQEKLVEKHKEIRQQILDEKP
KLQVELEQEYQDKFKRLPLEILEFVQEAMKGKISEDSNHGSAPLSLSSDPGKVNHKTPSS
EELGGDIPGKEFDTPL
NT seq 3651 nt NT seq  +upstreamnt  +downstreamnt
atggccggggctcaacccggagtgcacgccttgcaactcaagcccgtgtgcgtgtccgac
agcctcaagaagggcaccaaattcgtcaagtgggatgatgactcaactattgttactcca
attattttgaggactgaccctcagggatttttcttttactggacagatcagaacaaggag
acagagctactggatctcagccttgtcaaagatgccagatgtgggagacacgccaaagct
cccaaggaccccaaattacgtgaacttttggatgtggggaacatcgggcgcctggagcag
cgcatgatcacagtggtgtatgggcctgacctcgtgaacatctcccatttgaatctcgtg
gctttccaagaagaagtggccaaggaatggacaaatgaggttttcagtttggcaacaaac
ctgctggcccaaaacatgtccagggatgcatttctggaaaaagcctatactaaacttaag
ctgcaagtcactccagaagggcgtattcctctcaaaaacatatatcgcttgttttcagca
gaccggaagcgagttgaaactgctttagaggcttgtagtcttccatcttcaaggaatgat
tcaatacctcaagaagatttcactccagaagtgtacagagttttcctcaacaacctttgc
cctcgaccggaaattgataacatcttttcagaatttggtgccaaaagcaaaccatatctt
accgttgatcagatgatggattttatcaaccttaagcagcgagatcctcggcttaatgaa
atactttatccacctctaaaacaagagcaagtccaagtattgattgagaagtatgaaccc
aacaacagcctcgccagaaaaggacaaatatcagtggatgggttcatgcgctatctgagt
ggagaagaaaacggagtcgtttcacctgagaaactggatttgaatgaagacatgtctcag
cccctttctcactatttcattaattcctcgcacaacacctacctcacagctggccaactg
gctggaaactcctctgttgagatgtatcgccaagtgctcctgtctggttgtcgctgtgtg
gagctggactgctggaagggacggactgcagaagaggaacctgtcattacccatggcttc
accatgacaactgaaatatctttcaaggaagtgatagaagcaattgcggagtgtgcattt
aagacttcaccttttccaattctcctttcgtttgagaaccatgtggattccccaaagcag
caagccaagatggcggagtactgccgactgatctttggggatgcccttctcatggagccc
ctggaaaaatatccactggaatctggagttcctcttccaagccctatggatttaatgtat
aaaattttggtgaaaaataagaagaaatcacacaagtcatcagaaggaagcggcaaaaag
aagctctcagaacaagcctccaacacctacagtgactcctccagcatgttcgagccctca
tccccaggagccggagaagctgatacggaaagtgacgatgacgatgatgatgatgactgt
aaaaaatcttcaatggatgaggggactgctggaagtgaggctatggccacagaagaaatg
tctaatctggtgaactatattcagccagtcaagtttgagtcatttgaaatttcaaaaaaa
agaaataaaagttttgaaatgtcttccttcgtggaaaccaaaggacttgaacaactcacc
aagtctccagtggaatttgtagaatataacaaaatgcagcttagcaggatatatccaaaa
ggaacacgtgtggattcatccaactatatgcctcagctcttctggaatgcaggttgtcag
atggtggcacttaatttccagacaatggacctggctatgcaaataaatatggggatgtat
gaatacaacgggaagagtggctacagattgaagccagagttcatgaggaggcctgacaag
cattttgatccatttactgaaggcatcgtagatgggatagtggcaaacactttgtctgtt
aagattatttcaggtcagtttctttctgataagaaagttgggacttacgtggaagtggat
atgttcggtttgcctgtggatacaaggaggaaggcatttaagaccaaaacatcccaagga
aatgctgtgaatcctgtctgggaggaagaacctattgtgttcaaaaaggtggttcttcct
actctggcctgtttgagaatagcagtttatgaagaaggaggtaaattcattggccaccgt
atcttgccagtgcaagccattcggccaggctatcactatatctgtctaaggaatgaaagg
aaccagcctctgacgctgcctgctgtctttgtctacatagaagtgaaagactatgtgcca
gacacatatgcagatgtcatcgaagctttatcaaacccaatccgatatgtgaacctgatg
gaacagagagctaagcaattggctgctttgacactggaagatgaagaagaagtaaagaaa
gaggctgatcctggagaaacaccatcagaggctccaagtgaagcgagaacgactccagca
gaaaatggggtgaatcacactacaaccctgacacccaagccaccctcccaggctctccac
agccagccagctccaggttctgtaaaggcacctgccaaaacagaggatcttattcagagt
gtcttaacagaagtggaagcacagaccatcgaagaactaaagcaacagaaatcgtttgtg
aaacttcaaaagaaacactacaaagaaatgaaagacctggttaagagacaccacaagaaa
accactgaccttatcaaagaacacactaccaagtataatgaaattcagaatgactacttg
agaaggagagcagctttggaaaagtccgccaaaaaggacagtaagaaaaaatcggaaccc
agcagccctgatcatggttcatcaacgattgagcaagacctcgctgccctggatgctgaa
atgacccaaaagttaatagacttgaaggacaaacaacagcagcagctgcttaatcttcgg
caagaacagtattatagtgaaaaataccagaagcgagaacatattaaactgcttattcaa
aagttgacggatgtcgcagaagagtgtcagaacaatcagttaaagaagctcaaagaaatc
tgtgagaaagaaaagaaagaattaaagaagaaaatggataaaaagaggcaggagaagata
acagaagctaaatccaaagacaaaagtcagatggaagaggagaagacagagatgatccgg
tcatatatccaggaagtggtgcagtatatcaagaggctagaagaagcgcaaagtaaacgg
caagaaaaactcgtagagaaacacaaggaaatacgtcagcagatcctggatgaaaagccc
aagctgcaggtggagctggagcaagaataccaagacaaattcaaaagactgcccctcgag
attttggaattcgtgcaggaagccatgaaaggaaagatcagtgaagacagcaatcacggt
tctgcccctctctccctgtcctcagaccctggaaaagtgaaccacaagactccctccagt
gaggagctgggaggagacatcccaggaaaagaatttgatactcctctgtga

DBGET integrated database retrieval system