KEGG   Pan troglodytes (chimpanzee): 469875Help
Entry
469875            CDS       T01005                                 

Gene name
PLCB1
Definition
phospholipase C, beta 1 (phosphoinositide-specific)
Orthology
K05858  
phosphatidylinositol phospholipase C, beta [EC:3.1.4.11]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
Inositol phosphate metabolism
Metabolic pathways
Rap1 signaling pathway
Calcium signaling pathway
cGMP-PKG signaling pathway
Chemokine signaling pathway
Phosphatidylinositol signaling system
Adrenergic signaling in cardiomyocytes
Vascular smooth muscle contraction
Wnt signaling pathway
Gap junction
Platelet activation
Circadian entrainment
Long-term potentiation
Retrograde endocannabinoid signaling
Glutamatergic synapse
Cholinergic synapse
Serotonergic synapse
Dopaminergic synapse
Long-term depression
Inflammatory mediator regulation of TRP channels
Insulin secretion
GnRH signaling pathway
Estrogen signaling pathway
Melanogenesis
Thyroid hormone synthesis
Thyroid hormone signaling pathway
Oxytocin signaling pathway
Endocrine and other factor-regulated calcium reabsorption
Salivary secretion
Gastric acid secretion
Pancreatic secretion
Alzheimer's disease
Huntington's disease
Chagas disease (American trypanosomiasis)
African trypanosomiasis
Amoebiasis
Pathways in cancer
Module
Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:ptr00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    469875 (PLCB1)
 Environmental Information Processing
  Signal transduction
   04015 Rap1 signaling pathway
    469875 (PLCB1)
   04310 Wnt signaling pathway
    469875 (PLCB1)
   04020 Calcium signaling pathway
    469875 (PLCB1)
   04070 Phosphatidylinositol signaling system
    469875 (PLCB1)
   04022 cGMP - PKG signaling pathway
    469875 (PLCB1)
 Cellular Processes
  Cellular commiunity
   04540 Gap junction
    469875 (PLCB1)
 Organismal Systems
  Immune system
   04611 Platelet activation
    469875 (PLCB1)
   04062 Chemokine signaling pathway
    469875 (PLCB1)
  Endocrine system
   04911 Insulin secretion
    469875 (PLCB1)
   04912 GnRH signaling pathway
    469875 (PLCB1)
   04915 Estrogen signaling pathway
    469875 (PLCB1)
   04921 Oxytocin signaling pathway
    469875 (PLCB1)
   04918 Thyroid hormone synthesis
    469875 (PLCB1)
   04919 Thyroid hormone signaling pathway
    469875 (PLCB1)
   04916 Melanogenesis
    469875 (PLCB1)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    469875 (PLCB1)
   04270 Vascular smooth muscle contraction
    469875 (PLCB1)
  Digestive system
   04970 Salivary secretion
    469875 (PLCB1)
   04971 Gastric acid secretion
    469875 (PLCB1)
   04972 Pancreatic secretion
    469875 (PLCB1)
  Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    469875 (PLCB1)
  Nervous system
   04724 Glutamatergic synapse
    469875 (PLCB1)
   04725 Cholinergic synapse
    469875 (PLCB1)
   04728 Dopaminergic synapse
    469875 (PLCB1)
   04726 Serotonergic synapse
    469875 (PLCB1)
   04720 Long-term potentiation
    469875 (PLCB1)
   04730 Long-term depression
    469875 (PLCB1)
   04723 Retrograde endocannabinoid signaling
    469875 (PLCB1)
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    469875 (PLCB1)
  Environmental adaptation
   04713 Circadian entrainment
    469875 (PLCB1)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    469875 (PLCB1)
  Neurodegenerative diseases
   05010 Alzheimer's disease
    469875 (PLCB1)
   05016 Huntington's disease
    469875 (PLCB1)
  Infectious diseases
   05146 Amoebiasis
    469875 (PLCB1)
   05142 Chagas disease (American trypanosomiasis)
    469875 (PLCB1)
   05143 African trypanosomiasis
    469875 (PLCB1)
Enzymes [BR:ptr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     469875 (PLCB1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
20
AA seq 1211 aa AA seqDB search
MGSLQGIATKILIRILSDALIRKETDLKKSTIVTPIILRTDPQGFFFYWTDQNKETELLD
LSLVKDARCGRHAKAPKDPKLRELLDVGNIGRLEQRMITVVYGPDLVNISHLNLVAFQEE
VAKEWTNEVFSLATNLLAQNMSRDAFLEKAYTKLKLQVTPEGRIPLKNIYRLFSADRKRV
ETALEACSLPSSRNDSIPQEDFTPEVYRVFLNNLCPRPEIDNIFSEFGAKSKPYLTVDQM
MDFINLKQRDPRLNEILYPPLKQEQVQVLIEKYEPNNSLARKGQISVDGFMRYLSGEENG
VVSPEKLDLNEDMSQPLSHYFINSSHNTYLTAGQLAGNSSVEMYRQVLLSGCRCVELDCW
KGRTAEEEPVITHGFTMTTEISFKEVIEAIAECAFKTSPFPILLSFENHVDSPKQQAKMA
EYCRLIFGDALLMEPLEKYPLESGVPLPSPMDLMYKILVKNKKKSHKSSEGSGKKKLSEQ
ASNTYSDSSSMFEPSSPGAGEADTESDDDDDDDDCKKSSMDEGTAGSEAMATEEMSNLVN
YIQPVKFESFEISKKRNKSFEMSSFVETKGLEQLTKSPVEFVEYNKMQLSRIYPKGTRVD
SSNYMPQLFWNAGCQMVALNFQTMDLAMQINMGMYEYNGKSGYRLKPEFMRRPDKHFDPF
TEGIVDGIVANTLSVKIISGQFLSDKKVGTYVEVDMFGLPVDTRRKAFKTKTSQGNAVNP
VWEEEPIVFKKVVLPTLACLRIAVYEEGGKFIGHRILPVQAIRPGYHYICLRNERNQPLT
LPAVFVYIEVKDYVPDTYADVIEALSNPIRYVNLMEQRAKQLAALTLEDEEEVKKEADPG
ETPSEAPSEARTTPAENGVNHTTTLTPKPPSQALHSQPAPGSVKAPAKTEDLIQSVLTEV
EAQTIEELKQQKSFVKLQKKHYKEMKDLVKRHHKKTTDLIKEHTTKYNEIQNDYLRRRAA
LEKSAKKDSKKKSEPSSPDHGSSTIEQDLAALDAEMTQKLIDLKDKQQQQLLNLRQEQYY
SEKYQKREHIKLLIQKLTDVAEECQNNQLKKLKEICEKEKKELKKKMDKKRQEKITEAKS
KDKSQMEEEKTEMIRSYIQEVVQYIKRLEEAQSKRQEKLVEKHKEIRQQILDEKPKLQVE
LEQEYQDKFKRLPLEILEFVQEAMKGKISEDSNHGSAPLSLSSDPGKVNHKTPSSEELGG
DIPGKEFDTPL
NT seq 3636 nt NT seq  +upstreamnt  +downstreamnt
atgggatccttgcagggaatcgccaccaagattttgattagaattttgtcagatgctctg
ataagaaaagaaactgacctgaaaaagtcaactattgttactccaattattttgaggact
gaccctcagggatttttcttttactggacagatcagaacaaggagacagagctactggat
ctcagccttgtcaaagatgccagatgtgggagacacgccaaagctcccaaggaccccaaa
ttacgtgaacttttggatgtggggaacatcgggcgcctggagcagcgcatgatcacagtg
gtgtatgggcctgacctcgtgaacatctcccatttgaatctcgtggctttccaagaagaa
gtggccaaggaatggacaaatgaggttttcagtttggcaacaaacctgctggcccaaaac
atgtccagggatgcatttctggaaaaagcctatactaaacttaagctgcaagtcactcca
gaagggcgtattcctctcaaaaacatatatcgcttgttttcagcagaccggaagcgagtt
gaaactgctttagaggcttgtagtcttccatcttcaaggaatgattcaatacctcaagaa
gatttcactccagaagtgtacagagttttcctcaacaacctttgccctcgaccggaaatt
gataacatcttttcagaatttggtgccaaaagcaaaccatatcttaccgttgatcagatg
atggattttatcaaccttaagcagcgagatcctcggcttaatgaaatactttatccacct
ctaaaacaagagcaagtccaagtattgattgagaagtatgaacccaacaacagcctcgcc
agaaaaggacaaatatcagtggatgggttcatgcgctatctgagtggagaagaaaacgga
gtcgtttcacctgagaaactggatttgaatgaagacatgtctcagcccctttctcactat
ttcattaattcctcgcacaacacctacctcacagctggccaactggctggaaactcctct
gttgagatgtatcgccaagtgctcctgtctggttgtcgctgtgtggagctggactgctgg
aagggacggactgcagaagaggaacctgtcattacccatggcttcaccatgacaactgaa
atatctttcaaggaagtgatagaagcaattgcggagtgtgcatttaagacttcacctttt
ccaattctcctttcgtttgagaaccatgtggattccccaaagcagcaagccaagatggcg
gagtactgccgactgatctttggggatgcccttctcatggagcccctggaaaaatatcca
ctggaatctggagttcctcttccaagccctatggatttaatgtataaaattttggtgaaa
aataagaagaaatcacacaagtcatcagaaggaagcggcaaaaagaagctctcagaacaa
gcctccaacacctacagtgactcctccagcatgttcgagccctcatccccaggagccgga
gaagctgatacggaaagtgacgatgacgacgatgatgatgactgtaaaaaatcttcaatg
gatgaggggactgctggaagtgaggctatggccacagaagaaatgtctaatctggtgaac
tatattcagccagtcaagtttgagtcatttgaaatttcaaaaaaaagaaataaaagtttt
gaaatgtcttccttcgtggaaaccaaaggacttgaacaactcaccaagtctccagtggaa
tttgtagaatataacaaaatgcagcttagcaggatatatccaaaaggaacacgtgtggat
tcatccaactatatgcctcagctcttctggaatgcaggttgtcagatggtggcacttaat
ttccagacaatggacctggctatgcaaataaatatggggatgtatgaatacaacgggaag
agtggctacagattgaagccagagttcatgaggaggcctgacaagcattttgatccattt
actgaaggcatcgtagatgggatagtggcaaacactttgtctgttaagattatttcaggt
cagtttctttctgataagaaagttgggacttacgtggaagtggatatgttcggtttgcct
gtggatacaaggaggaaggcatttaagaccaaaacatcccaaggaaatgctgtgaatcct
gtctgggaggaagaacctattgtgttcaaaaaggtggttcttcctactctggcctgtttg
agaatagcagtttatgaagaaggaggtaaattcattggccaccgtatcttgccagtgcaa
gccattcggccaggctatcactatatctgtctaaggaatgaaaggaaccagcctctgacg
ctgcctgctgtctttgtctacatagaagtgaaagactatgtgccagacacatatgcagat
gtcatcgaagctttatcaaacccaatccgatatgtgaacctgatggaacagagagctaag
caattggctgctttgacactggaagatgaagaagaagtaaagaaagaggctgatcctgga
gaaacaccatcagaggctccaagtgaagcgagaacgactccagcagaaaatggggtgaat
cacactacaaccctgacacccaagccaccctcccaggctctccacagccagccagctcca
ggttctgtaaaggcacctgccaaaacagaggatcttattcagagtgtcttaacagaagtg
gaagcacagaccatcgaagaactaaagcaacagaaatcgtttgtgaaacttcaaaagaaa
cactacaaagaaatgaaagacctggttaagagacaccacaagaaaaccactgaccttatc
aaagaacacactaccaagtataatgaaattcagaatgactacttgagaaggagagcagct
ttggaaaagtccgccaaaaaggacagtaagaaaaaatcggaacccagcagccctgatcat
ggttcatcaacgattgagcaagacctcgctgccctggatgctgaaatgacccaaaagtta
atagacttgaaggacaaacaacagcagcagctgcttaatcttcggcaagaacagtattat
agtgaaaaataccagaagcgagaacatattaaactgcttattcaaaagttgacggatgtc
gcagaagagtgtcagaacaatcagttaaagaagctcaaagaaatctgtgagaaagaaaag
aaagaattaaagaagaaaatggataaaaagaggcaggagaagataacagaagctaaatcc
aaagacaaaagtcagatggaagaggagaagacagagatgatccggtcatatatccaggaa
gtggtgcagtatatcaagaggctagaagaagcgcaaagtaaacggcaagaaaaactcgta
gagaaacacaaggaaatacgtcagcagatcctggatgaaaagcccaagctgcaggtggag
ctggagcaagaataccaagacaaattcaaaagactgcccctcgagattttggaattcgtg
caggaagccatgaaaggaaagatcagtgaagacagcaatcacggttctgcccctctctcc
ctgtcctcagaccctggaaaagtgaaccacaagactccctccagtgaggagctgggagga
gacatcccaggaaaagaatttgatactcctctgtga

DBGET integrated database retrieval system