KEGG   Pan troglodytes (chimpanzee): 469982Help
Entry
469982            CDS       T01005                                 

Gene name
RAE1
Definition
RAE1 RNA export 1 homolog (S. pombe)
Orthology
K14298  
mRNA export factor
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
RNA transport
Influenza A
Module
Nuclear pore complex
Brite
KEGG Orthology (KO) [BR:ptr00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    469982 (RAE1)
 Human Diseases
  Infectious diseases
   05164 Influenza A
    469982 (RAE1)
Messenger RNA biogenesis [BR:ptr03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     469982 (RAE1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
20
AA seq 368 aa AA seqDB search
MSLFGTISGFGTSGTSMFGSATTDNHNPMKDIEVTSSPDDSIGCLSFSPPTLPGNFLIAG
SWANDVRCWEVQDSGQTIPKAQQMHTGPVLDVCWSDDGSKVFTASCDKTAKMWDLSSNQA
IQIAQHDAPVKTIHWIKAPNYSCVMTGSWDKTLKFWDTRSSNPMMVLQLPERCYCADVIY
PMAVVATAERGLIVYQLENQPSEFRRIESPLKHQHRCVAIFKDKQNKPTGFALGSIEGRV
AIHYINPPNPAKDNFTFKCHRSNGTNTSAPQDIYAVNGIAFHPVHGTLATVGSDGRFSFW
DKDARTKLKTSEQLDQPISACCFNHNGNIFAYASSYDWSKGHEFYNPQKKNYIFLRNAAE
ELKPRNKK
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atgagcctgtttggaacaatctcaggttttggaactagtgggaccagcatgtttggcagt
gcaaccacagacaatcacaatcccatgaaggatattgaagtaacatcatctcctgatgat
agcattggttgtctgtcttttagcccaccaaccttgccggggaactttcttattgcagga
tcatgggctaatgatgttcgctgctgggaagttcaagacagtggacagaccattccaaaa
gcccagcagatgcacactgggcctgtgctcgatgtctgctggagtgacgatgggagcaaa
gtatttacggcatcgtgtgataaaactgccaaaatgtgggacctcagcagtaaccaagca
atacagatcgcacagcatgatgctcctgttaaaaccatccattggatcaaagctccaaac
tacagctgtgtgatgactgggagctgggataagactttaaagttttgggatactcgatcg
tcaaatcctatgatggttttgcaactccctgaaaggtgttactgtgctgacgtgatatac
cccatggctgtggtggcaactgcagagaggggcctgattgtctatcagctagagaatcaa
ccttctgaattcaggaggatagaatctccactgaaacatcagcatcggtgtgtggctatt
tttaaagacaaacagaacaagcctactggttttgccctgggaagtatcgaggggagagtt
gctattcactatatcaaccccccgaaccccgccaaagataacttcacctttaaatgtcat
cgatctaatggaaccaacacttcagctcctcaggacatttacgcggtgaatggaatcgcg
ttccatcctgttcatggcacccttgcaactgtgggatctgatggtagattcagcttctgg
gacaaagatgccagaacaaaactaaaaacttcggaacagttagatcagcccatctcagct
tgctgtttcaatcacaatggaaacatatttgcgtacgcttccagctacgactggtcaaag
ggacatgaattttataatccccagaaaaaaaattacattttcctgcgtaatgcagccgaa
gagctaaagcccaggaataagaagtag

DBGET integrated database retrieval system