KEGG   Pan troglodytes (chimpanzee): 470228Help
Entry
470228            CDS       T01005                                 

Gene name
CYP2D6
Definition
cytochrome P450, family 2, subfamily D, polypeptide 6 (EC:1.14.14.1)
Orthology
K17712  
cytochrome P450, family 2, subfamily D, polypeptide 6 [EC:1.14.14.1]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Serotonergic synapse
Class
Metabolism; Xenobiotics biodegradation and metabolism; Metabolism of xenobiotics by cytochrome P450 [PATH:ptr00980]
Metabolism; Xenobiotics biodegradation and metabolism; Drug metabolism - cytochrome P450 [PATH:ptr00982]
Organismal Systems; Nervous system; Serotonergic synapse [PATH:ptr04726]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
22
AA seq 497 aa AA seqDB search
MGLEALVPLAVIVTIFLLLVDLMHRRQRWAARYPPGPLPLPGLGNLLHVDFQNTPYCFDQ
LRRRFGDVFSLQLAWTPVVVLNGLAAVREALVTHGEDTADRPPVPITQILGFGPRSQGVF
LARYGPAWREQRRFSVSTLRNLGLGKKSLEQWVTEEAACLCAAFANHSGRPFRPNGLLDK
AVSNVIASLTCGRRFEYDDPRFLRLLDLAQEGLKEESGFLREVLNAIPVLLHIPALAGKV
LRFQKAFLTQLDELLTEHRMTWDPAQPPRDLTEAFLAEMEKAKGNPESSFNDENLRIVVA
DLFSAGIVTTSTTLAWGLLLMILHPDVQRRVQQEIDDVIGQVRRPEMGDQARMPYTTAVI
HEVQRFGDIVPLGVTHMTSRDIEVQGFRIPKGTTLFTNLSSVLKDKAVWEKPFRFHPEHF
LDAQGHFVKPEAFLPFSAGRRACLGEPLARMELFLFFTSLLQHFSFSVPTGQPRPSHHGV
FAFLVTPSPYELCAVPR
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atggggctagaagcactggtgcccctggccgtgatagtgaccatcttcctgctcctggtg
gacctgatgcaccggcgccaacgctgggctgcacgctacccaccaggccccctgccactg
cccgggctgggcaacctgctgcatgtggacttccagaacacaccatactgcttcgaccag
ttgcggcgccgcttcggggacgtgttcagcctgcagctggcttggacgccggtggtcgtg
ctcaatgggctggcggccgtgcgcgaggcgctggtgacccacggcgaggacaccgccgac
cgcccccctgtgcccatcacccagatcctgggttttgggccgcgttcccaaggggtgttc
ctggcgcgctatgggcccgcgtggcgcgagcagaggcgcttctccgtgtccaccttgcgc
aacttgggcctgggcaagaagtcgctggagcagtgggtgaccgaggaggccgcctgcctt
tgtgccgccttcgccaaccactctggacgcccctttcgccccaacggcctcttggacaaa
gctgtgagcaacgtgatcgcctccctcacctgcgggcgccgcttcgagtacgacgaccct
cgcttcctcaggctgctggacctagctcaggagggactgaaggaggagtcgggctttctg
cgcgaggtgctgaatgccatccccgtcctcctgcacatcccagcgctggctggcaaggtc
ctacgcttccaaaaggctttcctgacccagctggatgagctgctaactgagcacaggatg
acctgggacccagcccagcccccccgagacctgactgaggccttcctggcagagatggag
aaggccaaggggaaccctgagagcagcttcaatgatgagaacctgcgcatagtggtggct
gacctgttctctgccgggatagtgaccacctcgaccacgctggcctggggcctcctgctc
atgatcctacatccggatgtgcagcgccgtgtccaacaggagatcgacgacgtgataggg
caggtgcggcgaccagagatgggtgaccaggctcgcatgccctacaccactgccgtgatt
cacgaggtgcagcgctttggggacatcgtccccctgggtgtgacccatatgacatcccgt
gacatcgaagtacagggcttccgcatccctaagggcacgacgctcttcaccaacctgtca
tcagtgctgaaggataaggctgtctgggagaagcccttccgcttccaccccgaacacttc
ctggatgcccagggccactttgtgaagccggaggccttcctgcctttctcagcaggccgc
cgcgcatgcctcggggagcccctggcccgcatggagctcttcctcttcttcacctccctg
ctgcagcacttcagcttctcggtgcccaccggacagccccggcccagccaccatggtgtc
tttgctttcctggtgaccccatccccctatgagctttgtgctgtgccccgctag

DBGET integrated database retrieval system