KEGG   Pan troglodytes (chimpanzee): 470228Help
Entry
470228            CDS       T01005                                 

Gene name
CYP2D6
Definition
cytochrome P450, family 2, subfamily D, polypeptide 6 (EC:1.14.14.1)
Orthology
K17712  
cytochrome P450, family 2, subfamily D, polypeptide 6 [EC:1.14.14.1]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Serotonergic synapse
Brite
KEGG Orthology (KO) [BR:ptr00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    470228 (CYP2D6)
   00982 Drug metabolism - cytochrome P450
    470228 (CYP2D6)
 Organismal Systems
  Nervous system
   04726 Serotonergic synapse
    470228 (CYP2D6)
Enzymes [BR:ptr01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     470228 (CYP2D6)
Cytochrome P450 [BR:ptr00199]
 Cytochrome P450, animal type
  CYP2 family
   470228 (CYP2D6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
22
AA seq 497 aa AA seqDB search
MGLEALVPLAVIVTIFLLLVDLMHRRQRWAARYPPGPLPLPGLGNLLHVDFQNTPYCFDQ
LRRRFGDVFSLQLAWTPVVVLNGLAAVREALVTHGEDTADRPPVPITQILGFGPRSQGVF
LARYGPAWREQRRFSVSTLRNLGLGKKSLEQWVTEEAACLCAAFANHSGRPFRPNGLLDK
AVSNVIASLTCGRRFEYDDPRFLRLLDLAQEGLKEESGFLREVLNAIPVLLHIPALAGKV
LRFQKAFLTQLDELLTEHRMTWDPAQPPRDLTEAFLAEMEKAKGNPESSFNDENLRIVVA
DLFSAGIVTTSTTLAWGLLLMILHPDVQRRVQQEIDDVIGQVRRPEMGDQARMPYTTAVI
HEVQRFGDIVPLGVTHMTSRDIEVQGFRIPKGTTLFTNLSSVLKDKAVWEKPFRFHPEHF
LDAQGHFVKPEAFLPFSAGRRACLGEPLARMELFLFFTSLLQHFSFSVPTGQPRPSHHGV
FAFLVTPSPYELCAVPR
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atggggctagaagcactggtgcccctggccgtgatagtgaccatcttcctgctcctggtg
gacctgatgcaccggcgccaacgctgggctgcacgctacccaccaggccccctgccactg
cccgggctgggcaacctgctgcatgtggacttccagaacacaccatactgcttcgaccag
ttgcggcgccgcttcggggacgtgttcagcctgcagctggcttggacgccggtggtcgtg
ctcaatgggctggcggccgtgcgcgaggcgctggtgacccacggcgaggacaccgccgac
cgcccccctgtgcccatcacccagatcctgggttttgggccgcgttcccaaggggtgttc
ctggcgcgctatgggcccgcgtggcgcgagcagaggcgcttctccgtgtccaccttgcgc
aacttgggcctgggcaagaagtcgctggagcagtgggtgaccgaggaggccgcctgcctt
tgtgccgccttcgccaaccactctggacgcccctttcgccccaacggcctcttggacaaa
gctgtgagcaacgtgatcgcctccctcacctgcgggcgccgcttcgagtacgacgaccct
cgcttcctcaggctgctggacctagctcaggagggactgaaggaggagtcgggctttctg
cgcgaggtgctgaatgccatccccgtcctcctgcacatcccagcgctggctggcaaggtc
ctacgcttccaaaaggctttcctgacccagctggatgagctgctaactgagcacaggatg
acctgggacccagcccagcccccccgagacctgactgaggccttcctggcagagatggag
aaggccaaggggaaccctgagagcagcttcaatgatgagaacctgcgcatagtggtggct
gacctgttctctgccgggatagtgaccacctcgaccacgctggcctggggcctcctgctc
atgatcctacatccggatgtgcagcgccgtgtccaacaggagatcgacgacgtgataggg
caggtgcggcgaccagagatgggtgaccaggctcgcatgccctacaccactgccgtgatt
cacgaggtgcagcgctttggggacatcgtccccctgggtgtgacccatatgacatcccgt
gacatcgaagtacagggcttccgcatccctaagggcacgacgctcttcaccaacctgtca
tcagtgctgaaggataaggctgtctgggagaagcccttccgcttccaccccgaacacttc
ctggatgcccagggccactttgtgaagccggaggccttcctgcctttctcagcaggccgc
cgcgcatgcctcggggagcccctggcccgcatggagctcttcctcttcttcacctccctg
ctgcagcacttcagcttctcggtgcccaccggacagccccggcccagccaccatggtgtc
tttgctttcctggtgaccccatccccctatgagctttgtgctgtgccccgctag

DBGET integrated database retrieval system