KEGG   Pan troglodytes (chimpanzee): 470606Help
Entry
470606            CDS       T01005                                 

Gene name
GLS
Definition
glutaminase
Orthology
K01425  
glutaminase [EC:3.5.1.2]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
D-Glutamine and D-glutamate metabolism
Metabolic pathways
Glutamatergic synapse
GABAergic synapse
Proximal tubule bicarbonate reclamation
MicroRNAs in cancer
Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:ptr00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    470606 (GLS)
   00330 Arginine and proline metabolism
    470606 (GLS)
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    470606 (GLS)
 Organismal Systems
  Excretory system
   04964 Proximal tubule bicarbonate reclamation
    470606 (GLS)
  Nervous system
   04724 Glutamatergic synapse
    470606 (GLS)
   04727 GABAergic synapse
    470606 (GLS)
 Human Diseases
  Cancers
   05230 Central carbon metabolism in cancer
    470606 (GLS)
   05206 MicroRNAs in cancer
    470606 (GLS)
Enzymes [BR:ptr01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     470606 (GLS)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
2B
AA seq 598 aa AA seqDB search
MMRLRGSGMLRDLLLRSPAGVSATLRRAQPLVTLCRRPRGGGRPAAGPAAAARLHPWWGG
GGWPAEPLARGLSSSPSEILQELGKGSTHPQPGVSPPAAPAAPGPKDGPGETDAFGNSEG
KELVASGENKIKQGLLPSLEDLLFYTIAEGQEKIPVHKFITALKSTGLRTSDPRLKECMD
MLRLTLQTTSDGVMLDKDLFKKCVQSNIVLLTQAFRRKFVIPDFMSFTSHIDELYESAKK
QSGGKVADYIPQLAKFSPDLWGVSVCTVDGQRHSTGDTKVPFCLQSCVKPLKYAIAVNDL
GTEYVHRYVGKEPSGLRFNKLFLNEDDKPHNPMVNAGAIVVTSLIKQGVNNAEKFDYVMQ
FLNKMAGNEYVGFSNATFQSERESGDRNFAIGYYLKEKKCFPEGTDMVGILDFYFQLCSI
EVTCESASVMAATLANGGFCPITGERVLSPEAVRNTLSLMHSCGMYDFSGQFAFHVGLPA
KSGVAGGILLVVPNVMGMMCWSPPLDKMGNSVKGIHFCHDLVSLCNFHNYDNLRHFAKKL
DPRREGGDQRHSFGPLDYESLQQELALKETVWKKVSPESNEDISTTVVYRMESLGEKS
NT seq 1797 nt NT seq  +upstreamnt  +downstreamnt
atgatgcggctgcgaggctcggggatgctgcgggacctgctcctgcggtcgcccgccggc
gtgagcgcgactctgcggcgggcacagcccttggtcaccctgtgccggcgtccccgaggc
gggggacggccggccgcgggcccggctgccgccgcgcgactccacccgtggtggggcggg
ggcggctggccggcggagcccctcgcgcggggcctgtccagctctccttcggagatcttg
caggagctgggcaaggggagcacgcatccgcagcccggggtgtcgccacccgctgccccg
gcggcgcccggccccaaggacggccccggggagacggacgcgtttggcaacagcgagggc
aaagagctggtggcctcaggtgaaaataaaataaaacagggtctgttacctagcttggaa
gatttgctgttctatacaattgcggaaggacaagagaaaatacctgttcataaatttatt
acagcactcaaatctacaggattgcgaacgtctgatcccaggttgaaagagtgtatggat
atgttaagattaactcttcaaacaacgtcagatggtgtcatgctagacaaagatcttttt
aaaaaatgtgttcagagcaacattgttttgttgacacaagcatttagaagaaagtttgtc
attcctgactttatgtcttttacctcacacattgatgagttatatgaaagtgctaaaaag
cagtctggaggaaaggttgcagattatattcctcaactggccaaattcagtcccgatttg
tggggtgtgtctgtttgtacagtagatggacagaggcattctactggagataccaaagtt
cccttctgtcttcagtcctgtgtaaaacctttgaaatatgccattgctgttaatgatctt
ggaactgaatatgtgcatcgatatgttggaaaagagccgagtggactaagattcaacaaa
ctatttttgaatgaagatgataaaccacataatcctatggtaaatgctggagcaattgtt
gtgacttcactaataaagcaaggagtaaataacgctgaaaaatttgactatgtcatgcag
tttttgaataagatggctggtaatgaatatgttggattcagtaatgcaacgtttcagtct
gaaagagaaagtggagatcgaaattttgcaataggatattacttaaaagaaaagaagtgt
tttccagaaggcacagacatggttggtatattagacttctacttccagctgtgctccatt
gaagtgacttgtgaatcagccagtgtgatggctgcgacactggctaatggtggtttctgc
ccaattactggtgaaagagtactgagccctgaagcagttcgaaatacattgagtttgatg
cattcctgtggcatgtatgacttctcagggcagtttgctttccatgttggtcttcctgca
aaatctggagttgctgggggcattcttttagttgtccccaatgttatgggtatgatgtgc
tggtctcctcctctggataagatgggcaacagtgttaagggaattcacttttgtcacgat
cttgtttctctgtgtaatttccataactatgataatttgagacactttgcaaaaaaactt
gatcctcgaagagaaggtggtgatcaaaggcattcctttggaccattggactatgaaagt
ctccaacaagaacttgctttaaaagagacagtgtggaaaaaagtgtcacctgagtcaaat
gaggacatctctacaactgtagtatatagaatggaaagtctgggagagaaaagctaa

DBGET integrated database retrieval system