KEGG   Pan troglodytes (chimpanzee): 471009Help
Entry
471009            CDS       T01005                                 

Gene name
USP13
Definition
ubiquitin specific peptidase 13 (isopeptidase T-3)
Orthology
K11836  
ubiquitin carboxyl-terminal hydrolase 5/13 [EC:3.1.2.15]
Organism
ptr  Pan troglodytes (chimpanzee)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3
AA seq 863 aa AA seqDB search
MQRRGALFGMPGGSGGRKMAAGDIGELLVPHMPTIRVPRSGDRVYKNECAFSYDSPNSEG
GLYVCMNTFLAFGREHVERHFRKTGQSVYMHLKRHVREKVRGASGGALPKRRNSKIFLDL
DTDDDLNSDDYEYEDEAKLVIFPDHYEIALPNIEELPALVTIACDAVLSSKSPYRKQDPD
TWENELPVSKYANNLTQLDNGVRIPPSGWKCARCDLRENLWLNLTDGSVLCGKWFFDSSG
GNGHALEHYRDMGYPLAVKLGTITPDGADVYSFQEEEPVLDPHLAKHLAHFGIDMLHMHG
TENGLQDNDIKPRVSEWEVIQESGTKLKPMYGPGYTGLKNLGNSCYLSSVMQAIFSIPEF
QRAYVGNLPRIFDYSPLDPTQDFNTQMTKLGHGLLSGQYSKPPVKSELIEQVMKEEHKPQ
QNGISPRMFKAFVSKSHPEFSSNRQQDAQEFFLHLVNLVERNRIGSENPSDVFRFLVEER
IQCCQTRKVRYTERVDYLMQLPVAMEAATNKDELIAYELTRREAEANRRPLPELVRAKIP
FSACLQAFSEPENVDDFWSSALQAKSAGVKTSRFASFPEYLVVQIKKFTFGLDWVPKKFD
VSIDMPDLLDINHLRARGLQPGEEELPDISPPIVIPDDSKDRLMNQLIDPSDIDESSVMQ
LAEMGFPLEACRKAVYFTGNMGAEVAFNWIIVHMEEPDFAEPLTMPGYGGAASAGASVFG
ASGLDNQPPEEVVAIITSMGFQRNQAIQALRATNNNLERALDWIFSHPEFEEDSDFVIEM
ENNANANIISEAKPEGPRVKDGSGTYELFAFISHMGTSTMSGHYICHIKKEGRWVIYNDH
KVCASERPPKDLGYMYFYRRIPS
NT seq 2592 nt NT seq  +upstreamnt  +downstreamnt
atgcagcgccggggcgccctgttcggcatgccgggcggcagcggaggcaggaagatggct
gcaggagacatcggcgagctgctagtgccccacatgcccacgatccgcgtgcccaggtcc
ggcgacagggtctacaagaacgagtgcgccttctcctacgactctcccaattctgaaggt
ggactctatgtatgcatgaatacatttttggcctttggaagggaacatgttgaaagacat
tttcgaaaaactggacagagtgtatacatgcacctgaaaagacatgtgcgagagaaggta
agaggggcgtctggtggagcgttaccaaaaaggaggaattccaagatttttttagatcta
gatactgatgacgatttaaatagcgacgattatgaatatgaagatgaagccaaacttgtt
atattcccagatcactatgaaatagcactaccaaatattgaggagttaccagccctggta
acaattgcttgtgatgcagttctcagctcaaaatctccatacagaaagcaggacccagac
acgtgggaaaatgaattgccagtatctaaatatgccaacaacctcacccagctggacaat
ggagtcaggattcctccaagtggttggaagtgtgccagatgtgacctgcgagaaaacctc
tggttgaatctgactgacggctctgtcctgtgtggaaagtggttctttgacagctctggg
ggcaacgggcatgcgctggagcattacagagacatgggctacccactagccgtgaaactg
ggaaccatcactcctgacggggcagatgtttattcttttcaagaagaagaacctgttttg
gatcctcatttggccaagcacttagcgcattttggaattgatatgcttcatatgcatggg
acagagaatgggctccaggacaatgacatcaagccgagggtcagtgagtgggaagtgatc
caggaatcgggcacgaagctgaagccaatgtatggtcctggctacacgggtctgaagaac
ctgggcaacagctgctatctcagctctgtcatgcaggccatcttcagcatcccagaattc
cagagagcgtatgtaggaaaccttcccagaatatttgactactcgcctttagatccaaca
caagatttcaacacacagatgactaagttaggacatggccttctctcaggccagtattca
aagcctccggtgaaatctgaactcattgaacaggtgatgaaggaggagcacaagccacag
cagaacgggatctctccgcgcatgtttaaggcctttgtaagcaagagccacccggaattc
tcctctaacaggcagcaagatgcccaggaattcttcttgcacctggtaaatctagtagag
aggaaccgcatcggctcagaaaacccaagcgatgtttttcgttttttggtggaagaacgc
attcagtgctgtcagacccggaaagtccgttacacggagagggtggattacctgatgcag
ttacctgtggccatggaggcggcaaccaacaaggatgaactgatcgcttatgaactaacg
agaagggaagcagaagcaaacagaagaccccttcctgagttggtacgtgccaagatacca
tttagtgcctgccttcaggccttctctgaaccagaaaatgttgatgatttctggagcagt
gccctacaagcaaagtctgcgggtgtgaaaacatctcgctttgcttcattccctgaatac
ttggtagtgcagataaagaagttcacttttggtcttgactgggttcccaaaaaatttgat
gtttctattgatatgccagacctacttgatatcaaccatctccgagccagggggttacag
ccaggagaggaagaacttccagacatcagcccccccatagtcattcctgatgactcaaaa
gatcgcctgatgaaccaattgatagacccatcagacatcgatgagtcatcagtgatgcag
ctggccgagatgggtttcccgctggaagcatgtcgcaaggctgtgtacttcactggaaat
atgggcgccgaggtggccttcaactggatcattgttcacatggaagagccagattttgct
gagccgctgaccatgcctggttatggaggggcagcttctgctggagcctctgtttttggt
gcttctggattggataaccaacctccagaggaagtcgtagctatcatcacctccatggga
tttcagcgaaatcaggctattcaggcactacgagcaacgaataataacctggaaagagca
ctggattggatctttagccaccctgagtttgaagaagacagtgattttgtgattgagatg
gagaataatgccaatgcaaacattatttctgaggccaagcccgaaggacctagagtcaag
gatggatctggaacatatgagctatttgcattcatcagtcacatgggaacatccacaatg
agtggtcattacatttgccatatcaaaaaggaaggaagatgggtgatttacaatgatcac
aaagtttgtgcctcagaaaggccccctaaagacctgggctacatgtacttttaccgcagg
ataccaagctaa

DBGET integrated database retrieval system