KEGG   Pan troglodytes (chimpanzee): 471141Help
Entry
471141            CDS       T01005                                 

Definition
ubiquitin carboxyl-terminal hydrolase 17-like
Orthology
K11845  
ubiquitin carboxyl-terminal hydrolase 17 [EC:3.1.2.15]
Organism
ptr  Pan troglodytes (chimpanzee)
Brite
Enzymes [BR:ptr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     471141
Peptidases [BR:ptr01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   471141
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4
AA seq 530 aa AA seqDB search
MEDDSLYLGGEWQFNHFSKLTSSRPDAAFAEIQRTSLPEKSPLSSETRVDLCDDLAPVAR
QLAPGEKLLLSSRRPAAVGAGLQNMGNTCYVNASLQCLTYTPPLANYMLSREHSQTCHRH
KGCMLCTMQAHITRALHIPGHVIQPSQALAAGFHRGKQEDAHEFLMFTVDAMEKACLPGH
KQVEHHSKDTTLIHQIFGGYWRSQIKCLHCHGISDTFDPYLDIALDIQAAQSVQQALEQL
VKPEELNGENAYHCGLCLQRAPASKTLTLHTSAKVLILVLKRFSDVTGNKLAKNVQYPEC
LDMQPYMSQQNTGPLVYVLYAVLVHAGWSCHNGHYFSYVKAQEGQWYKMDDAEVTASSIT
SVLSQQAYVLFYIQKSEWERHSESASRGREPRALGAEDTDRRATQGELKRDHPCLQAPEL
GEHLVERATQESTLDHWKFLQEQNKTKPEFNVRKVEGTLPPNVLVIHQSKYKCGMKNHHP
EQQSSLLNLSSTTPTDQESMNTGTLASLQGRTRRSKGKNKHSKRALLVCQ
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atggaggacgactcactctacttgggaggtgagtggcagttcaaccacttttcaaaactc
acatcttctcggccagatgcagcttttgctgaaatccagcggacttctctccctgagaag
tcaccactctcatctgagacccgtgtcgacctctgtgatgatttggctcctgtggcaaga
cagcttgctcccggggagaagcttcttctgagtagcaggagacctgctgcggtgggggct
gggctccagaatatgggaaatacctgctacgtgaacgcttccctgcagtgcctgacatac
acaccgccccttgccaactacatgctgtcccgggagcactctcaaacgtgtcatcgtcac
aagggctgcatgctctgtactatgcaagctcacatcacacgggccctccacattcctggc
catgtcatccagccctcacaggcattggctgctggcttccatagaggcaagcaggaagat
gcccatgaatttctcatgttcactgtggatgccatggaaaaggcatgccttcccgggcac
aagcaggtagagcatcactctaaggacaccaccctcatccaccaaatatttggaggctac
tggagatctcaaatcaagtgtctccactgccacggcatttcagacacttttgacccttac
ctggacatcgccctggatatccaggcagctcagagtgtccagcaagctttggaacagttg
gtgaagcccgaagaactcaatggagagaatgcctatcattgtggtctttgtctccagagg
gcgccggcctccaagacgttaactttacacacttctgccaaggtcctcatccttgtattg
aagagattctccgatgtcacaggcaacaaacttgccaagaatgtgcaatatcctgagtgc
cttgacatgcagccatacatgtctcagcagaacacaggacctcttgtctatgtcctctat
gctgtgctggtccacgctgggtggagttgtcacaacggacattacttctcttatgtcaaa
gctcaagaaggccagtggtataaaatggatgatgccgaggtcaccgcctctagcatcact
tctgtcctgagtcaacaggcctatgtcctcttttacatccagaagagtgaatgggaaaga
cacagtgagagtgcgtcaagaggcagggaaccaagagcccttggcgctgaagacacagac
aggcgagcaacgcaaggagagctcaagagagaccacccctgcctgcaggcacccgagttg
ggcgagcacttggtggaaagagccactcaggaaagcaccttagaccactggaaattcctt
caagagcaaaacaaaacgaagcctgagttcaacgtcagaaaagtcgaaggtaccctgcct
cccaacgtacttgtgattcatcaatcaaaatacaagtgtgggatgaagaaccatcatcct
gaacagcaaagctccctgctaaacctctcttcgacgaccccgacagatcaggagtccatg
aacactggcacactcgcttccctgcaggggaggaccaggagatccaaagggaagaacaaa
cacagcaagagggctctgcttgtgtgccagtga

DBGET integrated database retrieval system