KEGG   Pan troglodytes (chimpanzee): 471141Help
Entry
471141            CDS       T01005                                 

Definition
(RefSeq) ubiquitin carboxyl-terminal hydrolase 17-like protein 22
  KO
K11845  
ubiquitin carboxyl-terminal hydrolase 17 [EC:3.4.19.12]
Organism
ptr  Pan troglodytes (chimpanzee)
Brite
Enzymes [BR:ptr01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     471141
Peptidases [BR:ptr01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   471141
Ubiquitin system [BR:ptr04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UBP/USP
    471141
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
Position
Un
AA seq 228 aa AA seqDB search
MQPYMSQQNTGPLVYVLYAVLVHAGWSCHNGHYFSYVKAQEGQWYKMDDAEVTASSITSV
LSQQAYVLFYIQKSEWERHSESASRGREPRALGAEDTDRRATQGELKRDHPCLQAPELDE
HLVERATQESTLDHWKFLQEQNKTKPEFNVRKVEGTLPPNVLVIHQSKYKCGMKNHHPEQ
QSSLLNLSSTTPTDQESVNTGTLASLQGRTRRSKGKNKHSKRALLVCQ
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atgcagccatacatgtctcagcagaacacaggacctcttgtctatgtcctctatgctgtg
ctggtccacgctgggtggagttgtcacaacggacattacttctcttatgtcaaagctcaa
gaaggccagtggtataaaatggatgatgccgaggtcaccgcctctagcatcacttctgtc
ctgagtcaacaggcctatgtcctcttttacatccagaagagtgaatgggaaagacacagt
gagagtgcgtcaagaggcagggaaccaagagcccttggcgctgaagacacagacaggcga
gcaacgcaaggagagctcaagagagaccacccctgcctgcaggcacccgagttggacgag
cacttggtggaaagagccactcaggaaagcaccttagaccactggaaattccttcaagag
caaaacaaaacgaagcctgagttcaacgtcagaaaagtcgaaggtaccctgcctcccaac
gtacttgtgattcatcaatcaaaatacaagtgtgggatgaagaaccatcatcctgaacag
caaagctccctgctaaacctctcttcgacgaccccgacagatcaggagtccgtgaacact
ggcacactcgcttccctgcaggggaggaccaggagatccaaagggaagaacaaacacagc
aagagggctctgcttgtgtgccagtga

DBGET integrated database retrieval system