KEGG   Pan troglodytes (chimpanzee): 471220Help
Entry
471220            CDS       T01005                                 

Gene name
UGT2A3
Definition
UDP glucuronosyltransferase 2 family, polypeptide A3
Orthology
K00699  
glucuronosyltransferase [EC:2.4.1.17]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
Pentose and glucuronate interconversions
Ascorbate and aldarate metabolism
Steroid hormone biosynthesis
Starch and sucrose metabolism
Retinol metabolism
Porphyrin and chlorophyll metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Drug metabolism - other enzymes
Metabolic pathways
Chemical carcinogenesis
Module
Glucuronate pathway (uronate pathway)
Brite
KEGG Orthology (KO) [BR:ptr00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    471220 (UGT2A3)
   00053 Ascorbate and aldarate metabolism
    471220 (UGT2A3)
   00500 Starch and sucrose metabolism
    471220 (UGT2A3)
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    471220 (UGT2A3)
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    471220 (UGT2A3)
   00860 Porphyrin and chlorophyll metabolism
    471220 (UGT2A3)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    471220 (UGT2A3)
   00982 Drug metabolism - cytochrome P450
    471220 (UGT2A3)
   00983 Drug metabolism - other enzymes
    471220 (UGT2A3)
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    471220 (UGT2A3)
Enzymes [BR:ptr01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     471220 (UGT2A3)
Glycosyltransferases [BR:ptr01003]
 Others
  Hydrophobic molecule
   471220 (UGT2A3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
4
AA seq 238 aa AA seqDB search
MENFVQSSGEDGIVVFSLGSIFQNVTEEKANIIASALAQIPQKVLWRYKGKKPSTLGANT
RLYDWIPQNDLLGHPKTKAFITHGGMNGIYEAIYHGVPMVGVPIYGDQLDNIAHMKAKGA
AVEINFKTMTSEDLLRALRTVITDSSYKENAMRLSRIHHDQPVKPLDRAVFWIEFVMRHK
GAKHLRSAAHDLTWFQHYSIDVIGFLLACVATAIFLFTKCFLFSCQKFNKTRKIEKRE
NT seq 717 nt NT seq  +upstreamnt  +downstreamnt
atggaaaattttgtccagagttcaggggaagatggtattgtggtgttttctctggggtca
atatttcaaaatgttacagaagaaaaggctaatatcattgcttccgcccttgcccagatc
ccacagaaggtgttatggaggtacaaaggaaaaaaaccatccacattaggagccaatact
cggctgtatgattggataccccagaatgaccttcttggtcatcccaaaaccaaagctttt
atcactcatggtggaatgaatgggatctatgaagctatttaccatggggtccctatggtg
ggagttcccatatatggtgatcagcttgataacatagctcacatgaaggccaaaggagca
gctgtagaaataaacttcaaaactatgacaagcgaagatttactgagggctttgagaaca
gtcattaccgattcctcttataaagagaatgctatgagattatcaagaattcaccatgat
caacctgtaaagcccctagatcgagcagtcttctggatcgagtttgtcatgcgccacaaa
ggagccaagcacctgcgatcagcggcccatgacctcacctggttccagcactactctata
gatgtgattgggttcctgctggcctgtgtggcaactgctatattcttgttcacaaaatgt
tttttattttcctgtcaaaaatttaataaaactagaaagatagaaaagagggaatag

DBGET integrated database retrieval system