KEGG   Pan troglodytes (chimpanzee): 471257Help
Entry
471257            CDS       T01005                                 

Gene name
ADH7
Definition
alcohol dehydrogenase 7 (class IV), mu or sigma polypeptide
Orthology
K13951  
alcohol dehydrogenase 1/7 [EC:1.1.1.1]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Retinol metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Metabolic pathways
Chemical carcinogenesis
Brite
KEGG Orthology (KO) [BR:ptr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    471257 (ADH7)
  Lipid metabolism
   00071 Fatty acid degradation
    471257 (ADH7)
  Amino acid metabolism
   00350 Tyrosine metabolism
    471257 (ADH7)
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    471257 (ADH7)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    471257 (ADH7)
   00982 Drug metabolism - cytochrome P450
    471257 (ADH7)
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    471257 (ADH7)
Enzymes [BR:ptr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     471257 (ADH7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
4
AA seq 394 aa AA seqDB search
MKCLVSRHTVRETLDMVFQRMSVEAGVIKCKAAVLWEQKQPFSIEEIEVAPPKTKEVHIK
ILATGICRTDDHVIKGTMVSKFPVIVGHEATGIVESIGEGVTTVKPGDKVIPLFLPQCRE
CNACRNPDGNLCIRSDITGRGVLADGTTRFTCKGKPVHHFMNTSTFTEYTVVDESSVAKI
DDAAPPEKVCLIGCGFSTGYGAAVKTGKVKPGSTCVVFGLGGVGLSVIMGCKSAGASRII
GIDLNKDKFEKAMAVGATECISPKDSTKPISEVLSEMTGNNVGYTFEVIGHLETMIDALA
SCHMNYGTSVVVGVPPSAKMLTYDPMLLFTGRTWKGCVFGGLKSRDDVPKLVTEFLAKKF
DLDQLITHVLPFKKISEGFELLNSGQSIRTVLTF
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgaaatgcttggtgagcaggcatacagtgagggaaacactggatatggtgtttcagaga
atgtcagtggaagcaggggttattaaatgcaaagcagctgtgctttgggagcagaagcaa
cccttctccattgaggaaatagaagttgccccaccaaagactaaagaagttcacattaag
attttggccacaggaatctgtcgcacagatgaccatgtgataaaaggaacaatggtgtcc
aagtttccagtgattgtgggacatgaggcaactgggattgtagagagcattggagaagga
gtgactacagtgaaaccaggtgacaaagtcatccctctctttctgccacaatgtagagaa
tgcaatgcttgtcgcaacccagatggcaacctttgcattaggagcgatattactggtcgt
ggagtactggctgatggcaccaccagatttacatgcaagggcaaaccagtccaccacttc
atgaacaccagtacatttactgagtacacagtggtggatgaatcttctgttgctaagatt
gatgatgcagctcctcctgagaaagtctgtttaattggctgtgggttttccactggatat
ggggctgctgttaaaactggcaaggtcaaacctggttccacttgcgtcgtctttggcctg
ggaggagttggcctgtcagtcatcatgggctgtaagtcagctggtgcatctaggatcatt
gggattgacctcaacaaagacaaatttgagaaggccatggctgtaggtgccactgagtgt
atcagtcccaaggactctaccaaacccatcagtgaggtgctgtcagaaatgacgggcaac
aacgtgggatacacctttgaagttattgggcatcttgaaaccatgattgatgccctggca
tcctgccacatgaactatgggaccagcgtggtagtaggagttcctccatcagccaagatg
ctcacctatgacccgatgttgctcttcactggacgcacatggaagggatgtgtctttgga
ggtttgaaaagcagagatgatgtcccaaaactagtgactgagttcctggcaaagaaattt
gacctggaccagttgataactcatgttttaccatttaaaaaaatcagtgaaggatttgag
ctgctcaattcaggacaaagcattcgaacagtcctgacattttga

DBGET integrated database retrieval system