KEGG   Pan troglodytes (chimpanzee): 471564Help
Entry
471564            CDS       T01005                                 

Gene name
PRKAA1
Definition
protein kinase, AMP-activated, alpha 1 catalytic subunit
Orthology
K07198  
5'-AMP-activated protein kinase, catalytic alpha subunit [EC:2.7.11.11]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
FoxO signaling pathway
Regulation of autophagy
mTOR signaling pathway
PI3K-Akt signaling pathway
AMPK signaling pathway
Circadian rhythm
Insulin signaling pathway
Adipocytokine signaling pathway
Oxytocin signaling pathway
Non-alcoholic fatty liver disease (NAFLD)
Hypertrophic cardiomyopathy (HCM)
Brite
KEGG Orthology (KO) [BR:ptr00001]
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    471564 (PRKAA1)
   04151 PI3K-Akt signaling pathway
    471564 (PRKAA1)
   04152 AMPK signaling pathway
    471564 (PRKAA1)
   04150 mTOR signaling pathway
    471564 (PRKAA1)
 Cellular Processes
  Transport and catabolism
   04140 Regulation of autophagy
    471564 (PRKAA1)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    471564 (PRKAA1)
   04920 Adipocytokine signaling pathway
    471564 (PRKAA1)
   04921 Oxytocin signaling pathway
    471564 (PRKAA1)
  Environmental adaptation
   04710 Circadian rhythm
    471564 (PRKAA1)
 Human Diseases
  Cardiovascular diseases
   05410 Hypertrophic cardiomyopathy (HCM)
    471564 (PRKAA1)
  Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    471564 (PRKAA1)
Enzymes [BR:ptr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     471564 (PRKAA1)
Protein kinases [BR:ptr01001]
 Serine/threonine protein kinases: CAMK group
  CAMKL family
   471564 (PRKAA1)
Mitochondrial biogenesis [BR:ptr03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Other regulator of mitochondrial biogenesis
    471564 (PRKAA1)
  Mitophagy factors
   Other mitophagy factors
    471564 (PRKAA1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
5
AA seq 574 aa AA seqDB search
MRRLSSWRKMATAEKQKHDGRVKIGHYILGDTLGVGTFGKVKVGKHELTGHKVAVKILNR
QKIRSLDVVGKIRREIQNLKLFRHPHIIKLYQVISTPSDIFMVMEYVSGGELFDYICKNG
RKSDVPGVVKTGSTKELDEKESRRLFQQILSGVDYCHRHMVVHRDLKPENVLLDAHMNAK
IADFGLSNMMSDGEFLRTSCGSPNYAAPEVISGRLYAGPEVDIWSSGVILYALLCGTLPF
DDDHVPTLFKKICDGIFYTPQYLNPSVISLLKHMLQVDPMKRATIKDIREHEWFKQDLPK
YLFPEDPSYSSTMIDDEALKEVCEKFECSEEEVLSCLYNRNHQDPLAVAYHLIIDNRRIM
NEAKDFYLATSPPDSFLDDHHLTRPHPERVPFLVAETPRARHTLDELNPQKSKHQGVRKA
KWHLGIRSQSRPNDIMAEVCRAIKQLDYEWKVVNPYYLRVRRKNPVTSTYSKMSLQLYQV
DSRTYLLDFRSIDDEITEAKSGTATPQRSGSVSNYRSCQRSDSDAEAQGKSSEVSLTSSV
TSLDSSPVDLTPRPGSHTIEFFEMCANLIKILAQ
NT seq 1725 nt NT seq  +upstreamnt  +downstreamnt
atgcgcagactcagttcctggagaaagatggcgacagccgagaagcagaaacacgacggg
cgggtgaagatcggccactacattctgggtgacacgctgggggttggcaccttcggcaaa
gtgaaggttggcaaacatgaattgactgggcataaagtagctgtgaagatactcaatcga
cagaagattcggagccttgatgtggtaggaaaaatccgcagagaaattcagaacctcaag
cttttcaggcatcctcatataattaaactgtaccaggtcatcagtacaccatctgatatt
ttcatggtgatggaatatgtctcaggaggagagctatttgattatatctgtaagaatgga
aggaaatctgatgtacctggagtagtaaaaacaggctccacgaaggagctggatgaaaaa
gaaagtcggcgtctgttccaacagatcctttctggtgtggattattgtcacaggcatatg
gtggtccatagagatttgaaacctgaaaatgtcctgcttgatgcacacatgaatgcaaag
atagctgattttggtctttcaaacatgatgtcagatggtgaatttttaagaacaagttgt
ggctcacccaactatgctgcaccagaagtaatttcaggaagattgtatgcaggcccagag
gtagatatatggagcagtggggttattctctatgctttattatgtggaacccttccattt
gatgatgaccatgtgccaactctttttaagaagatatgtgatgggatcttctatacccct
caatatttaaatccttctgtgattagccttttgaaacatatgctgcaggtggatcccatg
aagagggccacaatcaaagatatcagggaacatgaatggtttaaacaggaccttccaaaa
tatctctttcctgaggatccatcatatagttcaaccatgattgatgatgaagccttaaaa
gaagtatgtgaaaagtttgagtgctcagaagaggaagttctcagctgtctttacaacaga
aatcaccaggatcctttggcagttgcctaccatctcataatagataacaggagaataatg
aatgaagccaaagatttctatttggcgacaagcccacctgattcttttcttgatgatcat
cacctgactcggccccatcctgaaagagtaccattcttggttgctgaaacaccaagggca
cgccatacccttgatgaattaaatccacagaaatccaaacaccaaggtgtaaggaaagca
aaatggcatttaggaattagaagtcaaagtcgaccaaatgatattatggcagaagtatgt
agagcaatcaaacaattggattatgaatggaaggttgtaaacccatattatttgcgtgta
cgaaggaagaatcctgtgacaagcacttactccaaaatgagtctacagttataccaagtg
gatagtagaacttatctactggatttccgtagtattgatgatgaaattacagaagccaaa
tcagggactgctactccacagagatcgggatcagttagcaactatcgatcttgccaaagg
agtgattcagatgctgaggctcaaggaaaatcctcagaagtttctcttacctcatctgtg
acctcacttgactcttctcctgttgacctaactccaagacctggaagtcacacaatagaa
ttttttgagatgtgtgcaaatctaattaaaattcttgcacaataa

DBGET integrated database retrieval system