KEGG   Pan troglodytes (chimpanzee): 471759Help
Entry
471759            CDS       T01005                                 

Gene name
PFN3
Definition
profilin 3
Orthology
K05759  
profilin
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
Rap1 signaling pathway
Regulation of actin cytoskeleton
Salmonella infection
Brite
KEGG Orthology (KO) [BR:ptr00001]
 Environmental Information Processing
  Signal transduction
   04015 Rap1 signaling pathway
    471759 (PFN3)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    471759 (PFN3)
 Human Diseases
  Infectious diseases
   05132 Salmonella infection
    471759 (PFN3)
Exosome [BR:ptr04147]
 Exosomal proteins
  Proteins found in most exosomes
   471759 (PFN3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
5
AA seq 137 aa AA seqDB search
MGDWKVYISAVLRDQRIDDVAIVGHADNSCVWASRPGGLLAAISPQEVGVLTGPDRHTFL
QAGLSVGGRRCCVIRDHLLAEGDGVLDARTKGLDARAVCVGRAPRALLVLMGRRGVHGGI
LNKTVHELIRGLRMQGA
NT seq 414 nt NT seq  +upstreamnt  +downstreamnt
atgggcgactggaaggtctacatcagtgcagtgctgcgggaccagcgcatcgacgacgtg
gccatcgtgggccatgcggacaacagctgcgtgtgggcttcgcggcccgggggcctgctg
gcggccatctcgccgcaggaggtgggcgtgctcacggggccggacaggcacaccttcctg
caggcgggcctgagcgtggggggccgccgctgctgcgtcatccgagaccacctcctggcc
gagggtgacggcgtgctggacgcacgcaccaaggggctggacgcgcgcgccgtgtgcgtg
ggccgtgcgccgcgcgcgctcctggtgctaatgggccgacgcggcgtacatgggggcatc
ctcaacaagacggtgcacgaactcatacgcgggctgcgcatgcagggcgcctag

  All links  
No link information was found.   
DBGET integrated database retrieval system